KEGG   Mus musculus (mouse): 110115
Entry
110115            CDS       T01002                                 

Gene name
Cyp11b1, AA389061, CPN1, Cyp11b, Cyp11b-1, FHI
Definition
(RefSeq) cytochrome P450, family 11, subfamily b, polypeptide 1
  KO
K00497  steroid 11beta-monooxygenase [EC:1.14.15.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu01100  Metabolic pathways
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
Module
mmu_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    110115 (Cyp11b1)
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    110115 (Cyp11b1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110115 (Cyp11b1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    110115 (Cyp11b1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     110115 (Cyp11b1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP11 family
   110115 (Cyp11b1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110115
NCBI-ProteinID: NP_001028401
MGI: 88583
Ensembl: ENSMUSG00000075604
Vega: OTTMUSG00000045157
UniProt: Q3TG86 Q3UQH5
Position
15 D3; 15 34.29 cM
AA seq 501 aa
MTMALRVTTDVWLARPWQCLHRTRALGTTATLAPKTLQPFEAIPQYSRNKWLKMIQILRE
QGQENLHLEMHQVFRELGPIFRHSVGKTQIVFVTLPEDVEKLYQVESTHPCRMPLESWIV
HRELRGLGRGVFLLNGPEWYFNRLQLNPNVLSPKAVQKFVPLVDGIARDFVDNLKKKMLE
SVHGSFSMDFQSSVFNYTIEASHFVLFGERLGLIGRDLSPDSLKFLHTLHSMFKTTTQLL
YLPRSLTRWTSTRVWKENLESWDFISEYVTKCIKNVYRELAEGRPQSWSVTAELVAERTL
SMDAIQANSMELIAGSTDTTSTPLVMTFFELARNPDVQQALRQESLAAEASIAANPQKAM
SDLPLLRAALKETLRLYPVGTFLERILSSDLVLQNYHVPAGTVLNVNLYSMGRNPAVFPR
PERYMPQRWLERKRSFKHLAFGFGVRQCLGRRLAEAEMMLLLHHVLKSFHVETQEKEDVR
MAYRFVLMPSSSPLLTFRPVN
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgacaatggctctcagggtgacaacagatgtgtggctggcaagaccctggcagtgcctg
cacaggacaagggcactgggcaccacggcaacactggccccaaagaccctgcagcccttt
gaagccataccacagtactccaggaacaagtggctgaagatgatacagatcctgagggag
cagggccaagaaaacctacacctggagatgcatcaggtcttccgggagctggggcccatt
ttcaggcacagtgtagggaaaacacagattgtgtttgtgacgttgccggaggatgttgag
aagctgtaccaggtagagagtacgcacccttgccgcatgcccttggaatcctggatagtc
catagagaactccgtggcctgggacgtggtgtgttcttgctaaatgggccagaatggtac
ttcaaccgactgcagctgaacccaaatgttctgtcaccaaaagccgttcaaaaatttgtc
cccttggtggatgggatagcaagggactttgtggataacctgaagaagaaaatgctggaa
agtgtccatggtagcttctctatggactttcagtccagtgtgttcaactataccatagaa
gctagccactttgttctttttggggagcggctgggcctcattggccgtgatctgagccct
gacagcctgaagttcctccacaccctgcactccatgttcaaaaccaccacacagctcttg
tacttgcccaggagcctgacccgatggacaagcaccagggtgtggaaagaaaacttagag
tcctgggatttcatctctgaatatgtcaccaaatgtatcaagaatgtgtatcgagagctg
gcagagggtcgtccacagtcctggagtgtcacagcagagctggtagctgagagaactctg
tcaatggatgccatccaggctaactcaatggaactcattgctggaagcactgacacgaca
tcaacccccttggtaatgactttctttgagctggctcggaacccagatgttcagcaggcc
ctgaggcaggagagcctggcagctgaggccagcatcgctgcaaatcctcagaaggccatg
tcagacctgcccttgctgagggctgcccttaaagagaccttgaggctctatcctgttggt
acttttctggagagaattctaagctcagacttggtgcttcagaactaccatgtccctgct
gggacagtcctcaatgtgaatctgtattccatgggccggaaccctgcagtgttcccaagg
cctgaacgctatatgcctcagcgctggctggagaggaaaaggagtttcaagcacctggcc
tttggctttggggtgcgccagtgcctggggaggcgcctggcagaggcagagatgatgctc
ctgcttcaccatgtgctgaaatccttccacgtggagacacaagagaaagaggatgtgcgg
atggcctaccgcttcgttttgatgcccagctccagtcctctcctcactttcaggcctgtc
aactag

DBGET integrated database retrieval system