KEGG   Mus musculus (mouse): 110135Help
Entry
110135            CDS       T01002                                 

Gene name
Fgb, 2510049G14Rik
Definition
(RefSeq) fibrinogen beta chain
  KO
K03904  fibrinogen beta chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110135 (Fgb)
   04611 Platelet activation
    110135 (Fgb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110135 (Fgb)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    110135 (Fgb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110135 (Fgb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   110135 (Fgb)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   110135 (Fgb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Fib_alpha CALCOCO1 FANCI_S2 KASH_CCD
Motif
Other DBs
NCBI-GeneID: 110135
NCBI-ProteinID: NP_862897
MGI: 99501
Ensembl: ENSMUSG00000033831
Vega: OTTMUSG00000051804
UniProt: Q8K0E8 Q3TGR2
Position
3 E3; 3 36.98 cM
AA seq 481 aa AA seqDB search
MRHLWLLLLLCVFSVQTQAADDDYDEPTDSLDARGHRPVDRRKEEPPSLRPAPPPISGGG
YRARPAKATANQKKVERRPPDAGGCLHADTDMGVLCPTGCTLQQTLLNQERPIKSSIAEL
NNNIQSVSDTSSVTFQYLTLLKDMWKKKQAQVKENENVINEYSSILEDQRLYIDETVNDN
IPLNLRVLRSILEDLRSKIQKLESDISAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGE
TSEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNE
DAKKYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEASKYQV
SVNKYKGTAGNALMDGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGG
GWWYNRCHAANPNGRYYWGGLYSWDMSKHGTDDGVVWMNWKGSWYSMRRMSMKIRPFFPQ
Q
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatctatggctgctgctgctattgtgtgttttctcagttcaaactcaagctgcc
gatgatgactacgatgaaccgacggatagcttggatgcccgtggtcatcgacctgttgac
aggagaaaggaagagcctcctagcctaagacctgcccctcctcctatcagtggagggggc
tatcgagcccgtccagccaaggctactgccaaccagaagaaagtagaacggagacccccc
gatgcaggaggctgtcttcatgctgacacagacatgggagtgttgtgtcctacgggatgt
acattgcaacaaacgttgttaaaccaggaaaggccaatcaagagtagtattgctgagtta
aataacaacatacagtctgtttccgatacctcctcagtcacctttcagtacctgactctg
ctaaaggacatgtggaaaaagaagcaagctcaagttaaagagaatgaaaatgtcataaat
gagtactcctccatcctggaagatcagagattatatattgatgagactgtgaatgataat
atcccccttaatcttcgtgtgctccgctcaatcctggaggacctgagaagcaaaatacaa
aaattagagtctgacatctcagctcaaatggaatactgccgcactccatgcactgtcagc
tgcaacattccagtggtgtctgggaaagagtgtgaggagatcattaggaagggaggtgag
acatccgaaatgtatctcatccagcctgacacctccatcaagccgtacagagtatactgt
gacatgaaaacagaaaacggaggatggacagtcatacagaaccgtcaggatggcagcgtc
gactttggcaggaaatgggacccatacaaaaaaggattcggaaatattgccaccaatgaa
gacgcgaagaagtactgtggcttgccaggtgaatattggcttggcaatgataagattagc
cagctcaccaggatgggacccacagaacttctcattgaaatggaggactggaaaggagac
aaggtgaaggcacattatggaggcttcacggtacagaacgaggccagcaaataccaagtc
tcagtgaacaaatacaaagggacggctggcaacgccctcatggacggggcctctcaactg
gtgggggagaacagaaccatgaccatccacaacggcatgttcttcagcacgtacgacagg
gacaacgacggctgggtaactacggatccaagaaaacagtgctccaaagaagatggtggt
ggctggtggtataacagatgccatgcagccaatccaaatggcagatactactggggtggc
ctttacagctgggacatgtccaagcacggcacagatgatggtgtggtgtggatgaactgg
aagggatcgtggtactcaatgaggaggatgtctatgaagatcaggcccttcttcccacag
caatag

DBGET integrated database retrieval system