KEGG   Mus musculus (mouse): 110135
Entry
110135            CDS       T01002                                 

Gene name
Fgb, 2510049G14Rik
Definition
(RefSeq) fibrinogen beta chain
  KO
K03904  fibrinogen beta chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110135 (Fgb)
   04611 Platelet activation
    110135 (Fgb)
   04613 Neutrophil extracellular trap formation
    110135 (Fgb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110135 (Fgb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110135 (Fgb)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    110135 (Fgb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110135 (Fgb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110135 (Fgb)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   110135 (Fgb)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha CALCOCO1 FANCI_S2 KASH_CCD
Other DBs
NCBI-GeneID: 110135
NCBI-ProteinID: NP_862897
MGI: 99501
Ensembl: ENSMUSG00000033831
Vega: OTTMUSG00000051804
UniProt: Q8K0E8 Q3TGR2
Position
3 E3; 3 36.98 cM
AA seq 481 aa
MRHLWLLLLLCVFSVQTQAADDDYDEPTDSLDARGHRPVDRRKEEPPSLRPAPPPISGGG
YRARPAKATANQKKVERRPPDAGGCLHADTDMGVLCPTGCTLQQTLLNQERPIKSSIAEL
NNNIQSVSDTSSVTFQYLTLLKDMWKKKQAQVKENENVINEYSSILEDQRLYIDETVNDN
IPLNLRVLRSILEDLRSKIQKLESDISAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGE
TSEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNE
DAKKYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEASKYQV
SVNKYKGTAGNALMDGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGG
GWWYNRCHAANPNGRYYWGGLYSWDMSKHGTDDGVVWMNWKGSWYSMRRMSMKIRPFFPQ
Q
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaggcatctatggctgctgctgctattgtgtgttttctcagttcaaactcaagctgcc
gatgatgactacgatgaaccgacggatagcttggatgcccgtggtcatcgacctgttgac
aggagaaaggaagagcctcctagcctaagacctgcccctcctcctatcagtggagggggc
tatcgagcccgtccagccaaggctactgccaaccagaagaaagtagaacggagacccccc
gatgcaggaggctgtcttcatgctgacacagacatgggagtgttgtgtcctacgggatgt
acattgcaacaaacgttgttaaaccaggaaaggccaatcaagagtagtattgctgagtta
aataacaacatacagtctgtttccgatacctcctcagtcacctttcagtacctgactctg
ctaaaggacatgtggaaaaagaagcaagctcaagttaaagagaatgaaaatgtcataaat
gagtactcctccatcctggaagatcagagattatatattgatgagactgtgaatgataat
atcccccttaatcttcgtgtgctccgctcaatcctggaggacctgagaagcaaaatacaa
aaattagagtctgacatctcagctcaaatggaatactgccgcactccatgcactgtcagc
tgcaacattccagtggtgtctgggaaagagtgtgaggagatcattaggaagggaggtgag
acatccgaaatgtatctcatccagcctgacacctccatcaagccgtacagagtatactgt
gacatgaaaacagaaaacggaggatggacagtcatacagaaccgtcaggatggcagcgtc
gactttggcaggaaatgggacccatacaaaaaaggattcggaaatattgccaccaatgaa
gacgcgaagaagtactgtggcttgccaggtgaatattggcttggcaatgataagattagc
cagctcaccaggatgggacccacagaacttctcattgaaatggaggactggaaaggagac
aaggtgaaggcacattatggaggcttcacggtacagaacgaggccagcaaataccaagtc
tcagtgaacaaatacaaagggacggctggcaacgccctcatggacggggcctctcaactg
gtgggggagaacagaaccatgaccatccacaacggcatgttcttcagcacgtacgacagg
gacaacgacggctgggtaactacggatccaagaaaacagtgctccaaagaagatggtggt
ggctggtggtataacagatgccatgcagccaatccaaatggcagatactactggggtggc
ctttacagctgggacatgtccaagcacggcacagatgatggtgtggtgtggatgaactgg
aagggatcgtggtactcaatgaggaggatgtctatgaagatcaggcccttcttcccacag
caatag

KEGG   Mus musculus (mouse): 14161
Entry
14161             CDS       T01002                                 

Gene name
Fga, Fi, Fib
Definition
(RefSeq) fibrinogen alpha chain
  KO
K03903  fibrinogen alpha chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14161 (Fga)
   04611 Platelet activation
    14161 (Fga)
   04613 Neutrophil extracellular trap formation
    14161 (Fga)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    14161 (Fga)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14161 (Fga)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14161 (Fga)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14161 (Fga)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   14161 (Fga)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   14161 (Fga)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha Fibrinogen_aC ORF6C 4_1_CTD
Other DBs
NCBI-GeneID: 14161
NCBI-ProteinID: NP_001104518
MGI: 1316726
Ensembl: ENSMUSG00000028001
Vega: OTTMUSG00000051803
UniProt: E9PV24
Position
3 E3; 3 36.96 cM
AA seq 789 aa
MLSLRVTCLILSVASTVWTTDTEDKGEFLSEGGGVRGPRVVERHQSQCKDSDWPFCSDDD
WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQRNNKDSNSLTRNIMEYLRGDFAN
ANNFDNTYGQVSEDLRRRIEILRRKVIEKAQQIQALQSNVRAQLIDMKRLEVDIDIKIRS
CKGSCSRAVNREINLQDYEGHQKQLQQVIAKELLPTKDRQYLPALKMSPVPDLVPGSFKS
QLQEAPPEWKALTEMRQMRMELERPGKDGGSRGDSPGDSRGDSRGDFATRGPGSKAENPT
NPGPGGSGYWRPGNSGSGSDGNRNPGTTGSDGTGDWGTGSPRPGSDSGNFRPANPNWGVF
SEFGDSSSPATRKEYHTGKAVTSKGDKELLIGKEKVTSSGTSTTHRSCSKTITKTVTGPD
GRREVVKEVITSDDGSDCGDATELDISHSFSGSLDELSERHPDLSGFFDNHFGLISPNFK
EFGSKTHSDSDILTNIEDPSSHVPEFSSSSKTSTVKKQVTKTYKMADEAGSEAHREGETR
NTKRGRARARPTRDCDDVLQTQTSGAQNGIFSIKPPGSSKVFSVYCDQETSLGGWLLIQQ
RMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRGSVLRVELEDWAGKEAY
AEYHFRVGSEAEGYALQVSSYRGTAGDALVQGSVEEGTEYTSHSNMQFSTFDRDADQWEE
NCAEVYGGGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVR
MKIRPLVGQ
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgctgtccctgagggtcacctgcctcatcttgagcgtggccagcacagtctggactaca
gataccgaagataaaggtgaattcctatcagaaggaggaggagtacgtggcccaagagtt
gtggagagacatcagagtcaatgcaaggactcagactggcccttctgctctgatgatgac
tggaaccacaaatgcccttcaggctgcaggatgaaagggttgattgacgaagccaaccag
gattttacaaacagaatcaacaagctcaaaaactcactatttgactttcaaaggaacaac
aaggattctaactcactgaccaggaatatcatggagtatttgagaggggacttcgcgaat
gccaacaactttgataacacttatgggcaagtgtcagaagacctgaggcgcagaattgag
atcctgaggcgaaaagtcatagagaaagcgcaacagattcaagctctgcagagcaatgtc
cgggctcagttgatagacatgaagcgcctggaggtggatattgatatcaagatccgctct
tgcaaagggtcctgcagcagggctgtaaaccgtgagataaatctacaggactatgaaggt
caccaaaaacagcttcaacaggtcatcgctaaagaattgcttcctacaaaagacaggcag
tacttgccagcactaaaaatgtctccagttcccgacttggttcccggaagttttaagagc
cagcttcaggaggcccctccagagtggaaggcattaacagaaatgcggcagatgagaatg
gagctggagagacctgggaaggatgggggttcgcgaggagattcaccaggagactcgcgg
ggagattctagaggggactttgcaacacgtggaccagggtcaaaggcagaaaaccccacg
aaccctggacctggtggatctgggtattggcgtcctgggaactccgggtctggaagtgat
ggaaatcggaaccctgggaccacggggtctgatggcactggagactggggtaccggaagc
cctagacctggctcagactctgggaactttaggcctgccaaccctaactggggtgtgttt
tcagagtttggagacagtagcagcccagccacaagaaaagagtatcacacaggtaaagcg
gtcacttctaaaggagataaagagctcctgattggaaaggagaaagtcacctcttctggc
acaagcaccacacatcgttcatgctctaaaaccattaccaagactgtcacaggtcctgat
ggtcgccgagaagtggtcaaagaagtgatcacctcggatgatggctcagactgtggcgat
gccaccgagttagacatatcccacagttttagcggcagtctcgacgaactctctgaaagg
catcctgacctttctgggttttttgacaaccactttggtttaatctcacctaacttcaaa
gaatttggcagtaagacccattctgattccgacatcctcacaaacattgaggaccccagc
tcccatgtacctgagttttcttccagtagtaaaacctcaactgtcaaaaaacaagtaacc
aagacctataaaatggcagacgaggcaggaagcgaagctcaccgggaaggagaaactcgc
aacactaagaggggccgtgccagagctcgcccaacgagagactgtgatgatgtcctccaa
acacaaacttcaggtgcccaaaatggcattttcagtatcaagccacctggatccagtaag
gttttttctgtttattgcgatcaagagaccagtttgggaggatggcttttgatccagcaa
agaatggatggatcgctgaattttaaccggacctggcaagactacaagagaggtttcggc
agcctgaatgacaaaggggaaggagaattctggctaggcaatgactacctccacttactc
actctgaggggctcagttctcagggttgaattagaggactgggctggaaaagaggcttat
gcggagtaccacttccgggtaggctctgaggcagagggctacgcgctgcaggtctcctcc
taccggggcactgctggagatgctctggtgcagggctctgtggaggaggggacagaatac
acctcacacagcaacatgcagttcagtacctttgacagagatgccgaccaatgggaagag
aactgtgcagaggtctatgggggaggctggtggtacaacagctgtcaggccgccaatctc
aatggcatttactaccccgggggcacctacgatcccaggaacaacagcccctatgagata
gagaacggggtggtctgggttcccttcagaggagcagattattccctcagggccgttcgg
atgaaaatcagaccgctggtgggacaatag

KEGG   Mus musculus (mouse): 99571
Entry
99571             CDS       T01002                                 

Gene name
Fgg, 3010002H13Rik, AI256424
Definition
(RefSeq) fibrinogen gamma chain
  KO
K03905  fibrinogen gamma chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    99571 (Fgg)
   04611 Platelet activation
    99571 (Fgg)
   04613 Neutrophil extracellular trap formation
    99571 (Fgg)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    99571 (Fgg)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    99571 (Fgg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    99571 (Fgg)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    99571 (Fgg)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   99571 (Fgg)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   99571 (Fgg)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   99571 (Fgg)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha Spc29 MscS_porin COG5
Other DBs
NCBI-GeneID: 99571
NCBI-ProteinID: NP_598623
MGI: 95526
Ensembl: ENSMUSG00000033860
Vega: OTTMUSG00000051802
UniProt: Q8VCM7 Q3UEM7
Position
3 E3; 3 36.94 cM
AA seq 436 aa
MSWSLQPPSFLLCCLLLLFSPTGLAYVATRDNCCILDERFGSFCPTTCGIADFLSSYQTD
VDNDLRTLEDILFRAENRTTEAKELIKAIQVYYNPDQPPKPGMIDSATQKSKKMVEEIVK
YEALLLTHETSIRYLQEIYNSNNQKITNLKQKVAQLEAQCQEPCKDSVQIHDTTGKDCQE
IANKGAKESGLYFIRPLKAKQQFLVYCEIDGSGNGWTVLQKRIDGSLDFKKNWIQYKEGF
GHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNGRTSTADYAMFRVGPESDKYR
LTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWW
MNKCHAGHLNGVYHQGGTYSKSSTTNGFDDGIIWATWKSRWYSMKETTMKIIPFNRLSIG
EGQQHHMGGSKQAGDV
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagttggtctttgcagcccccgagtttccttctttgctgcctgcttttactgttctct
ccaacgggcctggcatatgtggctaccagagataactgttgcatcctagatgagagattc
ggtagtttctgcccaaccacctgtggtatcgcagatttcctgtcttcttaccaaaccgac
gtggacaatgatctccgaacgctggaagacatcttattccgggctgaaaacagaaccaca
gaagccaaagaactgatcaaagcaattcaggtttactacaacccagaccaacccccaaag
ccaggtatgatagacagtgccactcagaagtctaagaagatggtagaagaaattgtgaaa
tacgaagcgctgctgttaacccacgagacaagcattcggtatttacaggaaatctataat
tcaaataaccagaagatcacaaacctaaaacagaaggtagcccagcttgaagcccagtgc
caggagccttgcaaggactctgtgcaaatccatgacacaactggaaaagattgtcaggaa
attgccaacaagggcgccaaagaaagtggactttacttcattcgacctttgaaagctaag
cagcagttcttagtgtactgtgaaatcgacggatctggaaatggttggaccgtattgcag
aagaggattgatggcagtttggatttcaagaagaactggattcagtataaagaaggattt
ggacacctgtcgcctactggcaccacagagttttggctgggaaatgagaagattcatttg
ataagcatgcagtccacaattccatatgcactgagaatacagctcaaagactggaatggc
agaaccagcactgcggactatgccatgttcagggtgggtcccgagtctgacaaataccgc
ctgacctatgcctacttcattggtggagatgccggggatgccttcgacggctacgatttc
ggcgatgaccccagtgacaagtttttcacatcccacaacggcatgcagttcagtacctgg
gacaacgacaacgataagtttgaaggcaactgtgcggaacaggatggatccggctggtgg
atgaacaaatgtcacgcaggccacctcaatggagtttatcaccaaggtggtacttactca
aaatcatctactactaatggtttcgacgacggcattatttgggcgacctggaaaagccgc
tggtattctatgaaggaaaccaccatgaagataattcccttcaacagactctccatcgga
gaaggacagcagcatcacatggggggatccaaacaggctggagacgtttaa

DBGET integrated database retrieval system