KEGG   Mus musculus (mouse): 110157Help
Entry
110157            CDS       T01002                                 

Gene name
Raf1, 6430402F14Rik, AA990557, BB129353, Craf1, D830050J10Rik, Raf-1, c-Raf, cRaf, v-Raf
Definition
(RefSeq) v-raf-leukemia viral oncogene 1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu04270  Vascular smooth muscle contraction
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05034  Alcoholism
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Module
mmu_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    110157 (Raf1)
   04015 Rap1 signaling pathway
    110157 (Raf1)
   04010 MAPK signaling pathway
    110157 (Raf1)
   04012 ErbB signaling pathway
    110157 (Raf1)
   04370 VEGF signaling pathway
    110157 (Raf1)
   04371 Apelin signaling pathway
    110157 (Raf1)
   04630 Jak-STAT signaling pathway
    110157 (Raf1)
   04068 FoxO signaling pathway
    110157 (Raf1)
   04072 Phospholipase D signaling pathway
    110157 (Raf1)
   04071 Sphingolipid signaling pathway
    110157 (Raf1)
   04024 cAMP signaling pathway
    110157 (Raf1)
   04022 cGMP - PKG signaling pathway
    110157 (Raf1)
   04151 PI3K-Akt signaling pathway
    110157 (Raf1)
   04150 mTOR signaling pathway
    110157 (Raf1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    110157 (Raf1)
  Cell growth and death
   04210 Apoptosis
    110157 (Raf1)
   04218 Cellular senescence
    110157 (Raf1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    110157 (Raf1)
   04540 Gap junction
    110157 (Raf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110157 (Raf1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    110157 (Raf1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    110157 (Raf1)
   04650 Natural killer cell mediated cytotoxicity
    110157 (Raf1)
   04660 T cell receptor signaling pathway
    110157 (Raf1)
   04662 B cell receptor signaling pathway
    110157 (Raf1)
   04664 Fc epsilon RI signaling pathway
    110157 (Raf1)
   04666 Fc gamma R-mediated phagocytosis
    110157 (Raf1)
   04062 Chemokine signaling pathway
    110157 (Raf1)
  Endocrine system
   04910 Insulin signaling pathway
    110157 (Raf1)
   04912 GnRH signaling pathway
    110157 (Raf1)
   04915 Estrogen signaling pathway
    110157 (Raf1)
   04914 Progesterone-mediated oocyte maturation
    110157 (Raf1)
   04917 Prolactin signaling pathway
    110157 (Raf1)
   04921 Oxytocin signaling pathway
    110157 (Raf1)
   04926 Relaxin signaling pathway
    110157 (Raf1)
   04919 Thyroid hormone signaling pathway
    110157 (Raf1)
   04928 Parathyroid hormone synthesis, secretion and action
    110157 (Raf1)
   04916 Melanogenesis
    110157 (Raf1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    110157 (Raf1)
  Nervous system
   04726 Serotonergic synapse
    110157 (Raf1)
   04720 Long-term potentiation
    110157 (Raf1)
   04730 Long-term depression
    110157 (Raf1)
   04722 Neurotrophin signaling pathway
    110157 (Raf1)
  Development
   04360 Axon guidance
    110157 (Raf1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    110157 (Raf1)
   05230 Central carbon metabolism in cancer
    110157 (Raf1)
   05231 Choline metabolism in cancer
    110157 (Raf1)
   05206 MicroRNAs in cancer
    110157 (Raf1)
   05205 Proteoglycans in cancer
    110157 (Raf1)
   05210 Colorectal cancer
    110157 (Raf1)
   05212 Pancreatic cancer
    110157 (Raf1)
   05225 Hepatocellular carcinoma
    110157 (Raf1)
   05226 Gastric cancer
    110157 (Raf1)
   05214 Glioma
    110157 (Raf1)
   05221 Acute myeloid leukemia
    110157 (Raf1)
   05220 Chronic myeloid leukemia
    110157 (Raf1)
   05218 Melanoma
    110157 (Raf1)
   05211 Renal cell carcinoma
    110157 (Raf1)
   05219 Bladder cancer
    110157 (Raf1)
   05215 Prostate cancer
    110157 (Raf1)
   05213 Endometrial cancer
    110157 (Raf1)
   05224 Breast cancer
    110157 (Raf1)
   05223 Non-small cell lung cancer
    110157 (Raf1)
  Substance dependence
   05034 Alcoholism
    110157 (Raf1)
  Infectious diseases
   05152 Tuberculosis
    110157 (Raf1)
   05164 Influenza A
    110157 (Raf1)
   05161 Hepatitis B
    110157 (Raf1)
   05160 Hepatitis C
    110157 (Raf1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    110157 (Raf1)
   05165 Human papillomavirus infection
    110157 (Raf1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    110157 (Raf1)
   01522 Endocrine resistance
    110157 (Raf1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110157 (Raf1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110157 (Raf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2
Motif
Other DBs
NCBI-GeneID: 110157
NCBI-ProteinID: NP_084056
MGI: 97847
Ensembl: ENSMUSG00000000441
Vega: OTTMUSG00000020697
UniProt: Q99N57
Position
6 E3; 6 53.62 cM
AA seq 648 aa AA seqDB search
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPAPPSFPMRRMRESVSRMPASSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLHVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDDNPFSFQSDVYSYGIVLYE
LMAGELPYAHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggctttggactcaaagatgcg
gtgtttgatggctccagctgcatctcccctaccattgttcagcagtttggctatcagcgc
cgggcctcagatgatggcaagctcacggattcttctaagacaagcaatactatccgggtt
ttcttgccgaataagcaaaggactgtggtcaatgtgcggaatggaatgagcttacatgac
tgccttatgaaagctctgaaggtgagaggcctgcagccagagtgctgtgcagtgttcaga
cttctccaggaacacaaaggtaagaaagcacgcttagattggaacaccgatgccgcctct
ctgattggagaagaactgcaagtggattttttggatcatgttccactcacaactcacaac
tttgctcggaaaacgttcctgaagcttgcattctgtgacatctgtcagaagttcctgcta
aatggatttcgatgtcagacttgtggctacaagtttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctcttgctgtttccaaattccact
gttggtgacagtggagtcccagcaccaccttctttcccaatgcgtcggatgcgagaatct
gtttcccggatgcctgctagttcccagcacagatactctacaccccatgccttcactttc
aacacctccagcccttcctcagaaggttccctgtcccagaggcagaggtcaacgtccact
cccaatgtccacatggtcagcaccaccctgcatgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcagcctcaccttcagccctgtccagcagcccaaacaacctg
agtccaacaggctggtcacagcccaaaacccctgtgccagcacaaagagagcgggcacca
ggatctgggacccaggaaaaaaacaaaattaggcctcgtgggcagagagactcgagttat
tactgggaaatagaagccagtgaggtgatgctgtctactcggatcgggtcaggttccttt
ggcactgtgtacaagggcaagtggcatggagatgttgcagtaaagatcctaaaggtggtt
gacccaactccagagcaacttcaggccttcaggaacgaggtggctgttttgcgcaaaaca
cggcatgttaacatcctgctgttcatggggtacatgacaaaggacaacctggcgattgtg
actcagtggtgtgaaggcagcagtctctacaaacacctgcatgtccaggagaccaaattc
cagatgttccagctaattgacattgcccgacagacagctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctc
acggtgaaaattggagattttggtttggcaacagtgaagtcacgctggagtggttctcag
caggttgaacagcccactggctctgtgctgtggatggccccagaagtaatccggatgcag
gatgacaacccgttcagcttccagtccgacgtgtactcgtacggcatcgtgctgtacgag
ctgatggctggggagcttccctacgcccacatcaacaaccgagaccagatcatcttcatg
gtaggccgtgggtatgcatcccctgatctcagcaggctctacaagaactgccccaaggca
atgaagaggttggtggctgactgtgtgaagaaagtcaaagaagagagacctttgtttccc
cagatcctgtcttccatcgagctgcttcagcactctctgccgaaaatcaacaggagcgcc
tctgagccttccctgcatcgggcagctcacactgaggacatcaatgcttgcacgctgact
acatccccaaggctaccagtcttctag

DBGET integrated database retrieval system