KEGG   Mus musculus (house mouse): 110198
Entry
110198            CDS       T01002                                 
Symbol
Akr7a5, 0610025K21Rik, Afar, Afar1, Akr7a2
Name
(RefSeq) aldo-keto reductase family 7, member A5 (aflatoxin aldehyde reductase)
  KO
K15303  aflatoxin B1 aldehyde reductase
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00980  Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110198 (Akr7a5)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 110198
NCBI-ProteinID: NP_079613
MGI: 107796
Ensembl: ENSMUSG00000028743
UniProt: Q8CG76
Structure
Position
4:139038005..139046097
AA seq 367 aa
MLRAASRAVGRAAVRSAQRSGTSVGRPLAMSRPPPPRAASGAPLRPATVLGTMEMGRRMD
ASASAASVRAFLERGHSELDTAFMYCDGQSENILGGLGLGLGSGDCTVKIATKANPWEGK
SLKPDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVEETLRACHQLHQEGKFVELGLSN
YASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNPLAGGL
LTGKYKYEDKDGKQPVGRFFGNNWAETYRNRFWKEHHFEAIALVEKALQTTYGTNAPRMT
SAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEGPLEPAVVEAFDQAWNMVAH
ECPNYFR
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgctgcgtgcagcgtccagagccgtgggccgcgctgctgttcgctccgcgcagcgctcc
gggacttcggtcgggcgtcctctcgccatgtcccggcctccgccaccccgcgccgcctct
ggcgcccctctccggcccgctacggtgctgggcaccatggagatggggcgtcgcatggat
gcgagtgctagcgccgcttcggtccgcgccttcctggagcgcggccacagcgagctggac
acggccttcatgtactgcgacggccagtccgagaacatcctgggcggcctggggctcggg
ctgggcagcggcgactgcacagtgaaaatcgccaccaaggccaacccctgggaagggaag
tcactgaagcctgacagcatccggtcccagttagagacgtctctgaagcggctgcagtgt
ccccgggtggatctcttctacttacacgctcccgaccacagcactcctgtggaggagaca
cttcgtgcctgccaccagctgcatcaggagggcaagtttgtggagcttggtctgtctaac
tatgcctcctgggaagtggctgagatctgtaccctctgcaagagcaacggctggatcctg
ccaactgtgtaccagggcatgtacaacgccaccacccggcaggtggaggccgagctcctc
ccctgcctcagacacttcggactgaggttctacgcctacaaccctttggctgggggcctg
ctgactggcaagtataaatacgaagacaaggatgggaaacaacccgtgggccgcttcttt
gggaataactgggctgagacctacaggaaccgcttctggaaggaacaccactttgaggcc
atcgccctggtagaaaaggccctgcagaccacctatggcaccaacgccccccgcatgacc
tcggccgccctgcgctggatgtaccaccactcgcagctccagggcacccgaggggacgca
gtcatcttgggcatgtccagtctggagcagctggagcagaacttggccgccactgaggaa
gggcccctggagccggctgtcgtggaagcctttgaccaagcctggaacatggtcgcccac
gagtgtcccaactacttcagatag

DBGET integrated database retrieval system