KEGG   Mus musculus (mouse): 110257Help
Entry
110257            CDS       T01002                                 

Gene name
Hba-a2
Definition
(RefSeq) hemoglobin alpha, adult chain 2
  KO
K13822  hemoglobin subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05144 Malaria
    110257 (Hba-a2)
   05143 African trypanosomiasis
    110257 (Hba-a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110257 (Hba-a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   110257 (Hba-a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin
Motif
Other DBs
NCBI-GeneID: 110257
NCBI-ProteinID: NP_001077424
MGI: 96016
Ensembl: ENSMUSG00000069917
Vega: OTTMUSG00000005376
UniProt: Q91VB8
Structure
PDB: 

Position
11 A4; 11 18.87 cM
AA seq 142 aa AA seqDB search
MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG
KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP
AVHASLDKFLASVSTVLTSKYR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctctggggaagacaaaagcaacatcaaggctgcctgggggaagattggtggc
catggtgctgaatatggagctgaagccctggaaaggatgtttgctagcttccccaccacc
aagacctacttccctcactttgatgtaagccacggctctgcccaggtcaagggtcacggc
aagaaggtcgccgatgctctggccaatgctgcaggccacctcgatgacctgcccggtgcc
ctgtctgctctgagcgacctgcatgcccacaagctgcgtgtggatcccgtcaacttcaag
ctcctgagccactgcctgctggtgaccttggctagccaccaccctgccgatttcaccccc
gcggtgcatgcctctctggataaattccttgcctctgtgagcaccgtgctgacctccaag
taccgttaa

DBGET integrated database retrieval system