KEGG   Mus musculus (house mouse): 110279
Entry
110279            CDS       T01002                                 
Symbol
Bcr, 5133400C09Rik, AI561783, AI853148, mKIAA3017
Name
(RefSeq) BCR activator of RhoGEF and GTPase
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05200  Pathways in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110279 (Bcr)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110279 (Bcr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    110279 (Bcr)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    110279 (Bcr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110279 (Bcr)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  BCR family
   110279 (Bcr)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    110279 (Bcr)
SSDB
Motif
Pfam: RhoGAP Bcr-Abl_Oligo RhoGEF PH_19 C2 PH IQ_SEC7_PH PH_5
Other DBs
NCBI-GeneID: 110279
NCBI-ProteinID: NP_001074881
MGI: 88141
Ensembl: ENSMUSG00000009681
UniProt: Q6PAJ1 A2RRK7
Position
10:74896384..75020755
AA seq 1270 aa
MVDSVGFAEAWRAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRASAPRPPPAPADGADPAPVEESEARPDGE
GSPSKGRSASARRPAAAASADRDDRGPPTSVAALRSNFEKIRKGPAQPGSADAEKPFYVN
VEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQQSAGQGLGEAPRPHYRGRSSESS
CGLDGDYEDAELNPRFLKDNLINANGGNRPPWPPLEYQPYQSIYVGGMMVEGEGKSPLLR
SQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPT
TYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQCQVVVSEATIVGVRKTGQIWPSDG
DSTFQGEADSSFGTPPGYGCAADQAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSLASGA
LDPTKVSELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQ
QIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVA
METAEKCCQANAQFAEISENLRARSNKDVKDSTTKNSLETLLYKPVDRVTRSTLVLHDLL
KHTPSSHPDHSLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEG
ARKLRHIFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEALPNIPLVPD
EELDALKIKISQIKSDIQREKRANKGSKVMERLRKKLSEQESLLLLMSPSMAFRVHSRNG
KSYTFLISSDYERAEWRESIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHHIPLTINK
EDDESPGLYGFLHVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEE
FEIELEGSQTLRILCYEKCYNKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVID
MNGIEVKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERR
GMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFT
DEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLH
NLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSK
RQSILFSTEV
NT seq 3813 nt   +upstreamnt  +downstreamnt
atggtggactcggtgggcttcgccgaggcgtggagggcgcagttcccggactcggagccg
ccgcgcatggagctgcgctcggtgggtgacatcgagcaggagctggagcgctgcaaggcc
tccattaggcgcttggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgctgctggccaaggagaagaagagctacgatcggcagcgctggggcttccgccgtgca
gcgcagccccccgacggcgccgccgagccccgagcgtccgccccgcgcccgccgcccgcg
cccgccgacggcgcagacccggcgcccgtcgaggagtccgaggcgcggccggacggagag
gggtcaccgagtaaggggcggtcagcgtccgcccgcaggccagcggctgctgcatcggcg
gaccgggacgaccgagggccccccaccagcgtggcggcgctcagatccaacttcgagaag
atccgcaagggacctgcccagcccggctctgccgacgccgagaagcccttctacgtgaac
gtcgagttccaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtccgaccga
atcagttccctgggcagccaggccatgcaaatggagcgcaagaagtcccagcagagcgcc
gggcagggcctgggggaagcacccagaccccattaccgtgggcgctcctcggaaagcagt
tgcggccttgacggtgactatgaggatgcagagttgaatccccgcttcctgaaggacaac
ctaataaatgccaacggcggcaacaggcccccttggccgcccctggagtaccaaccctac
cagagcatctatgtcggaggcatgatggtggaaggggagggcaagagccctctcctgcga
agccagagcacttcagagcaggagaaacgcctaacctggcctcgcaggtcctactcgcct
cggagtttcgaggacagcggaggtggctacacgccggactgcagctccaacgagaacctc
acctccagcgaggaggacttttcctctggccagtccagccgcgtgtcaccaagccccacc
acctaccgcatgttccgggacaagagccgctcaccctcgcagaattcgcagcagtccttt
gacagcagcagccccccgacgccacagtgccagaagcggcaccggcagtgccaggttgtg
gtgtctgaggctaccatcgtgggtgtccgcaagactgggcagatctggcccagtgatggg
gacagcacctttcaaggggaagcagattcctcgtttggaacaccacctggatatggctgt
gccgcagaccaggctgaggaacagcgccggcaccaggacgggctgccctacatcgatgat
tcaccttcttcctcgccacacctcagcagcaaaggcagaggcagcctggcctcaggcgcc
ctggatcccaccaaagtgagtgagctggatctggaaaagggcctggagatgagaaagtgg
gttttgtccggaatcctggccagcgaggagacgtacctgagccatctggaggccctgctg
ctgcccatgaagcctctgaaagccgctgccaccacctctcagcctgtgctgaccagccag
cagattgagaccattttcttcaaagtgcctgagctctacgagatccacaaggagttctac
gatgggctgttcccccgagtgcagcagtggagccaccagcagcgtgtaggggacctcttc
cagaagctggccagccagctgggtgtgtaccgagcctttgtggataactacggagtggcc
atggaaactgcagagaagtgctgtcaggccaacgctcagtttgcagaaatctctgagaac
ctgcgagccagaagcaacaaggatgtcaaggactcaactaccaagaactctttggaaact
ctgctctacaaacctgtggaccgggtgacgaggagcacgctagtccttcacgacttgcta
aaacacaccccgtccagccatcccgaccattccctgctgcaagacgccctccgaatctct
cagaacttcctgtccagcatcaacgaggagatcacgccccgccgacagtccatgacggtg
aaaaaaggagagcaccggcagctgctgaaggacagctttatggtagagctggtggagggg
gcccgcaagctgcgtcacatcttcctgttcactgacctgctcctctgcaccaagctgaag
aagcaaagtggaggcaaaacccagcaatatgactgtaaatggtacattccgctcacggac
ctcagcttccagatggtggatgaattggaggcactacccaacatccctctggtgccagat
gaggaactggatgccttgaagatcaaaatctcccaaatcaagagcgacatccaacgagag
aagagagcaaataagggcagcaaggtcatggagaggctgaggaagaagctgtcagagcag
gagtcactgctgctgttaatgtctcccagcatggccttccgcgttcacagtcgcaacggc
aagagttacacgttccttatttcctctgactatgagcgagccgagtggagagaaagcatc
cgagagcagcagaagaaatgtttcaaaagtttctctctgacatctgtggagctacaaatg
ctgaccaactcatgtgtaaaacttcagacggttcaccacattccactgaccatcaacaaa
gaagatgacgagtctcctggactctacggcttcctgcatgtcatcgtccactcagccacc
ggctttaagcagagctcaaatctctactgcaccctggaggtggattcctttggatatttt
gtgaataaagcaaagactcgagtctacagggacacaactgagccaaactggaatgaggag
tttgagatagagctagaaggctcccagaccctgcggatactatgttatgaaaagtgttac
aacaaaatgaagatgacgaaggaagatggtgagagcgcagacaagctcatggggaaaggc
caggtccagctggacccccaaaccctacaggacagagactggcagcggactgtcatcgac
atgaatggaattgaagtgaaactctccgtcaagttcacgagcagggagttcagcctgaag
agaatgccctcccgcaaacagacaggggtcttcggtgtcaagattgctgtagtcacaaag
agagagaggtccaaggtaccttacattgtgcgccagtgtgtggaagagatcgagcgccgg
ggtatggaggaggtgggcatctaccgagtgtctggagtggccacagacatccaggcactg
aaggcagcctttgatgtcaataacaaggatgtgtccgtgatgatgagcgagatggacgtg
aacgccattgccggcacgctgaagctctacttccgtgagctgcccgagcccctcttcacg
gatgagttctaccctaacttcgcagaaggcattgctctttcagaccccgtcgcaaaggag
agctgcatgctgaacctgctgctgtccctcccagaagccaacctgctcaccttcctcttc
ctcctggaccacctgaaaagggtagctgaaaaggagacggtgaacaagatgtccctgcac
aacctcgccacggtctttggccccacactgcttcggccctcagagaaggaaagcaagctc
cctgctaaccccagccagcccatcaccatgactgacagctggtccctggaggtcatgtcc
caggtccaagtgttgctgtacttcctgcagctggaggccatccctgcccctgacagcaag
agacagagcatcctgttttccactgaagtctaa

DBGET integrated database retrieval system