KEGG   Mus musculus (mouse): 110304Help
Entry
110304            CDS       T01002                                 

Gene name
Glra3
Definition
(RefSeq) glycine receptor, alpha 3 subunit
  KO
K05195  glycine receptor alpha-3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110304 (Glra3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    110304 (Glra3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Glycine
   110304 (Glra3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 110304
NCBI-ProteinID: NP_536686
MGI: 95749
Ensembl: ENSMUSG00000038257
Vega: OTTMUSG00000036483
UniProt: Q91XP5 G5E811
Position
8 B2; 8 29.69 cM
AA seq 464 aa AA seqDB search
MAHVRHFRTLVSGFYFWEAALLLSLVATKETNSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgtgagacactttcggacactagtttctggattttacttctgggaagccgca
ctgttactgagtttggtggccacaaaggaaacaaacagtgcgcgatctcgaagtgctcca
atgtcaccttctgattttctggacaaactaatggggaggacatcggggtatgatgcaaga
atcagacccaacttcaaaggtcctccagttaatgtcacatgcaacatattcataaacagc
tttggctccattgcagagacgactatggattacagagtaaacatttttcttcgtcagaag
tggaatgatcctcgtcttgcatacagtgaatatcctgacgattcattagaccttgacccg
tctatgttggattccatttggaaacctgacttgttctttgctaatgagaagggggctaac
ttccacgaagtcaccacagataacaagctgctaagaattttcaaaaatggaaatgtcctt
tattcaataaggttgacattaacactctcctgtccaatggatctcaagaatttcccaatg
gatgtacaaacatgcataatgcaacttgaaagctttgggtacacaatgaatgatctcatt
tttgaatggcaagatgaagccccagtacaagtggctgaaggactcactttgcctcaattt
ctgttgaaagaagaaaaggacttgcggtactgcactaaacactacaatacaggaaagttt
acatgcatagaagtgcgattccatcttgagcgtcagatgggctattacttgatccagatg
tacatccccagcctcctgatcgttattctatcctgggtctcattctggattaacatggat
gcagccccagctagagtagctttgggcatcaccactgtacttactatgaccacacagagt
tctggatcccgggcctccttaccaaaggtgtcatacgtcaaggctattgacatttggatg
gcggtgtgcctcctttttgtgttctcagcacttctggagtatgcagccgtgaattttgtc
tcaaggcaacacaaggagctgttgaggtttcggcgaaagagaaagaataagacggaagct
tttgcactggagaagttttaccgtttctcagacacggatgatgaggtgagggagagtcga
ttcagcttcactgcctatggaatggggccctgtctgcaagccaaggatggtgtggttcca
aaaggccccaaccacgctgtccaggtcatgccaaagagccctgatgaaatgaggaaggtc
ttcatcgacagggctaagaagattgacaccatctcccgagcctgctttccgctagcattc
ctgatttttaacattttctactgggttatctataaaatccttaggcatgaagacattcat
cagcagcaagactaa

DBGET integrated database retrieval system