KEGG   Mus musculus (house mouse): 110308
Entry
110308            CDS       T01002                                 
Symbol
Krt5, 3300001P10Rik, AW146334, CK5, K5, Krt2-5, Tfip8
Name
(RefSeq) keratin 5
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    110308 (Krt5)
   04147 Exosome [BR:mmu04147]
    110308 (Krt5)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     110308 (Krt5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   110308 (Krt5)
  Exosomal proteins of other body fluids (saliva and urine)
   110308 (Krt5)
  Exosomal proteins of colorectal cancer cells
   110308 (Krt5)
  Exosomal proteins of bladder cancer cells
   110308 (Krt5)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 ATG16 CENP-F_leu_zip Alanine_zipper Nuf2_DHR10-like APG6_N Taxilin Tropomyosin_1 Baculo_PEP_C DUF745 Mce4_CUP1 SlyX T7SS_ESX_EspC Bap31_Bap29_C Golgin_A5 CATRA-C ADIP
Other DBs
NCBI-GeneID: 110308
NCBI-ProteinID: NP_081287
MGI: 96702
Ensembl: ENSMUSG00000061527
UniProt: Q922U2 Q32P04
Position
15:complement(101615504..101621340)
AA seq 580 aa
MSRQSSVSFRSGGSRSFSAASAITPSVSRTSFSSVSRSGGGGGGRISLGGACGAGGYGSR
SLYNVGGSKRISYSSGGGSFRNQFGAGGFGFGGGAGSGFGFGGGAGSGFGFGGGAGFGGG
YGGAGFPVCPPGGIQEVTVNQNLLTPLNLQIDPTIQRVRTEEREQIKTLNNKFASFIDKV
RFLEQQNKVLDTKWALLQEQGTKTIKQNLDPLFEQYINNLRRQLDGVLGERGRLDSELRN
MQDLVEDYKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEARVDALMDEINFMKMF
FDAELSQMQTHVSDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRTEAESWYQTKYE
ELQQTAGRHGDDLRNTKHEISEMNRMIQRLRSEIDNVKKQCANLQNAIAEAEQRGELALK
DARNKLTELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGV
GPVNISVVTNSVSSGYGGGSSIGVGSGFGGGLGSGFAGGLGPRFTRGGGGLGLGSGLSVG
GSGFSAGSSQGGMSFGSGGGSGSSVKFVSTTSSSRRSFKS
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtctcgccagtccagtgtgtccttccgaagtgggggcagccgctctttcagcgccgcc
tctgccatcaccccatctgtctctcgtacgagcttcagctcggtgtcccgcagtggtggt
ggtggtggtggcaggatcagccttgggggtgcttgtggagccgggggctatggcagccgg
agcctgtacaatgtggggggctccaaaaggatatcctacagttctggcggaggcagcttc
aggaaccaatttggtgctggtggctttggctttggaggaggagccggcagtggatttggt
tttggtggtggagctggtagtggctttggcttcggtggtggagctggctttggtggtggc
tatgggggagctggcttcccggtgtgcccacctggaggcatccaagaggtcaccgttaac
cagaacctcctcacccctctgaacctgcaaatcgaccccaccatccagcgggtcaggact
gaggagagggagcagatcaagaccctcaacaacaagtttgcctccttcatcgacaaggtg
cggttcctggagcagcagaacaaggtcctggacaccaagtgggccctgctgcaggagcag
ggcaccaagaccataaagcagaacctggatccgttgtttgaacagtacattaacaacctc
cgtagacagctggacggggttctgggggagaggggccgcctggactcagagctgaggaac
atgcaggacctggtggaggactacaagaacaagtatgaggatgagatcaacaagcgtacc
acggctgagaatgagtttgtgatgttgaagaaggatgtggatgctgcctacatgaacaag
gtggagctggaggccagggtcgatgccctgatggacgagatcaacttcatgaagatgttc
tttgatgcggagctgtcccagatgcagacacacgtctctgacacatctgtggtcctttcc
atggacaacaaccgcagcctggacctggacagcatcatcgctgaggtcaaggcccagtac
gaggacattgccaaccgcagccgaacagaggctgagtcctggtaccagaccaagtatgag
gagctgcaacagacagctggccgtcatggcgatgaccttcgaaacaccaagcacgagatc
tctgagatgaaccgaatgatccagaggctgagatctgaaattgacaacgtcaagaagcag
tgtgccaacctccagaacgccattgctgaagctgagcaacgcggggagctggctctcaaa
gatgccagaaacaagctgacagagctggaggaggccctgcagaaggccaagcaggacatg
gccaggctgctgcgggagtaccaggagctcatgaacaccaagctggctctggacgtggag
atcgccacctacaggaagctgctggagggcgaggagtgcaggctgagtggggaaggagtt
ggaccagtcaacatctctgtcgttacaaacagtgtctcttctggctacggaggaggcagc
agcattggtgttggcagtggctttggcggtggccttggcagcggctttgctggtggcctt
ggcccacgcttcaccaggggtggtgggggtcttggtttgggtagcgggctaagtgtgggg
ggctctggcttcagtgcaggcagcagtcaaggaggcatgagcttcggcagtggtggtggc
agcggctccagtgtcaaatttgtctccaccacctcctcctcccggaggagcttcaagagc
taa

DBGET integrated database retrieval system