KEGG   Mus musculus (mouse): 110323
Entry
110323            CDS       T01002                                 

Gene name
Cox6b1, 2010000G05Rik, COX_VIb-1, Cox6b
Definition
(RefSeq) cytochrome c oxidase, subunit 6B1
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110323 (Cox6b1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110323 (Cox6b1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110323 (Cox6b1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110323 (Cox6b1)
   05012 Parkinson disease
    110323 (Cox6b1)
   05014 Amyotrophic lateral sclerosis
    110323 (Cox6b1)
   05016 Huntington disease
    110323 (Cox6b1)
   05020 Prion disease
    110323 (Cox6b1)
   05022 Pathways of neurodegeneration - multiple diseases
    110323 (Cox6b1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110323 (Cox6b1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110323 (Cox6b1)
SSDB
Motif
Pfam: COX6B YozE_SAM_like
Other DBs
NCBI-GeneID: 110323
NCBI-ProteinID: NP_079904
MGI: 107460
Ensembl: ENSMUSG00000036751
Vega: OTTMUSG00000059367
UniProt: P56391
Position
7 B1; 7 18.84 cM
AA seq 86 aa
MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRV
YKSLCPVSWVSAWDDRIAEGTFPGKI
NT seq 261 nt   +upstreamnt  +downstreamnt
atggctgaagacatcaagactaaaatcaagaactacaaaactgccccctttgacagccgc
ttccccaaccagaaccagactaagaactgttggcagaactacctggacttccaccgctgt
gagaaggcaatgacggccaaggggggtgatgtctccgtgtgtgagtggtaccggcgtgtg
tacaagtccctctgtcccgtgtcatgggtctcagcctgggatgaccgcatagctgaaggc
acatttcctgggaagatctga

KEGG   Mus musculus (mouse): 12857
Entry
12857             CDS       T01002                                 

Gene name
Cox4i1, AL024441, CO, COX, COX_IV-1, COXIV, Cox4, Cox4a, IV-1
Definition
(RefSeq) cytochrome c oxidase subunit 4I1
  KO
K02263  cytochrome c oxidase subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12857 (Cox4i1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12857 (Cox4i1)
  09159 Environmental adaptation
   04714 Thermogenesis
    12857 (Cox4i1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12857 (Cox4i1)
   05012 Parkinson disease
    12857 (Cox4i1)
   05014 Amyotrophic lateral sclerosis
    12857 (Cox4i1)
   05016 Huntington disease
    12857 (Cox4i1)
   05020 Prion disease
    12857 (Cox4i1)
   05022 Pathways of neurodegeneration - multiple diseases
    12857 (Cox4i1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12857 (Cox4i1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12857 (Cox4i1)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 12857
NCBI-ProteinID: NP_001280488
MGI: 88473
Ensembl: ENSMUSG00000031818
Vega: OTTMUSG00000043013
UniProt: P19783 A2RSV8
Position
8 E1; 8 69.99 cM
AA seq 169 aa
MLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQK
ALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIW
EKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttggcttccagagcgctgagcctgattggcaagagagccatttctacttcggtgtgc
cttcgagcacatgggagtgttgtgaagagtgaagactatgctttccccacttacgctgat
cggcgtgactaccccttgcctgatgtggcccatgtcacgatgctgtctgccagccagaag
gcgctgaaggagaaggagaaggccgactggagcagcctttccagggatgagaaagttcag
ttgtaccgcatccagtttaacgagagcttcgccgagatgaacaggggcaccaatgaatgg
aagacagttgtgggcatggccatgttcttcattggcttcactgcgctcgttctgatttgg
gagaagagctatgtgtatggccccatccctcatactttcgatcgtgactgggtggccatg
cagaccaagcgaatgctggacatgaaggccaaccccattcagggcttctccgccaagtgg
gactatgacaagaatgagtggaagaagtga

KEGG   Mus musculus (mouse): 12858
Entry
12858             CDS       T01002                                 

Gene name
Cox5a, AA959768, CcO, CcOX
Definition
(RefSeq) cytochrome c oxidase subunit 5A
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12858 (Cox5a)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12858 (Cox5a)
  09159 Environmental adaptation
   04714 Thermogenesis
    12858 (Cox5a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12858 (Cox5a)
   05012 Parkinson disease
    12858 (Cox5a)
   05014 Amyotrophic lateral sclerosis
    12858 (Cox5a)
   05016 Huntington disease
    12858 (Cox5a)
   05020 Prion disease
    12858 (Cox5a)
   05022 Pathways of neurodegeneration - multiple diseases
    12858 (Cox5a)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12858 (Cox5a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12858 (Cox5a)
SSDB
Motif
Pfam: COX5A
Other DBs
NCBI-GeneID: 12858
NCBI-ProteinID: NP_031773
MGI: 88474
Ensembl: ENSMUSG00000000088
Vega: OTTMUSG00000063187
UniProt: P12787
Position
9; 9 B
AA seq 146 aa
MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPD
IDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYP
YVIQELRPTLNELGISTPEELGLDKV
NT seq 441 nt   +upstreamnt  +downstreamnt
atgctcgccgctgccctccgtcgctgtaccgcagccgcggctgcccgaggcctcctgcac
cccgcctcggctcccagccccgccgccgctgtctgttccattcgctgctattctcatggg
tcacacgagacagatgaggagtttgatgctcgctgggtgacatatttcaacaagccagac
attgatgcctgggaattgcgtaaagggatgaatacacttgttggctatgatctggttcct
gagcccaaaatcattgatgctgcattgcgagcatgtagacggttaaatgattttgctagt
gctgttcgcatcttggaggttgttaaggacaaagcaggacctcataaggaaatctatccc
tatgtcatccaggaacttagaccaactttaaatgaattgggaatctccactccagaggag
ctgggccttgacaaagtgtaa

KEGG   Mus musculus (mouse): 12859
Entry
12859             CDS       T01002                                 

Gene name
Cox5b
Definition
(RefSeq) cytochrome c oxidase subunit 5B
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12859 (Cox5b)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12859 (Cox5b)
  09159 Environmental adaptation
   04714 Thermogenesis
    12859 (Cox5b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12859 (Cox5b)
   05012 Parkinson disease
    12859 (Cox5b)
   05014 Amyotrophic lateral sclerosis
    12859 (Cox5b)
   05016 Huntington disease
    12859 (Cox5b)
   05020 Prion disease
    12859 (Cox5b)
   05022 Pathways of neurodegeneration - multiple diseases
    12859 (Cox5b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12859 (Cox5b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12859 (Cox5b)
SSDB
Motif
Pfam: COX5B zf-RING_4 zinc_ribbon_5 zf-CHCC
Other DBs
NCBI-GeneID: 12859
NCBI-ProteinID: NP_034072
MGI: 88475
Ensembl: ENSMUSG00000061518
Vega: OTTMUSG00000049480
UniProt: Q9D881
Position
1; 1 B
AA seq 129 aa
MASRLLRGVGALAAQALRAHGPRGAAVTRSMASGGGVPTDEEQATGLEREIMIAAQKGLD
PYNMLPPKAASGTKEDPNLVPSISNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTHY
KLVPHQMAH
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcttcaaggttacttcgcggagtgggcgctttggcggcgcaggccctgagggcccac
ggcccccgtggcgcggccgtgacccgctccatggcttctggaggtggtgtccccactgat
gaggagcaggctactgggctggagagggagatcatgatagcagcacagaagggactggac
ccatacaatatgctacctccaaaggcagcttcaggcaccaaggaagaccctaatctagtc
ccgtccatcagcaacaagagaatagtgggctgcatctgtgaagaggacaactgtactgtc
atctggttttggctgcacaaaggcgagagtcagcgatgccccaactgtggaacccattac
aagctggtgccccaccaaatggcccactga

KEGG   Mus musculus (mouse): 12861
Entry
12861             CDS       T01002                                 

Gene name
Cox6a1, VIaL
Definition
(RefSeq) cytochrome c oxidase subunit 6A1
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12861 (Cox6a1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12861 (Cox6a1)
  09159 Environmental adaptation
   04714 Thermogenesis
    12861 (Cox6a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12861 (Cox6a1)
   05012 Parkinson disease
    12861 (Cox6a1)
   05014 Amyotrophic lateral sclerosis
    12861 (Cox6a1)
   05016 Huntington disease
    12861 (Cox6a1)
   05020 Prion disease
    12861 (Cox6a1)
   05022 Pathways of neurodegeneration - multiple diseases
    12861 (Cox6a1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12861 (Cox6a1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12861 (Cox6a1)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 12861
NCBI-ProteinID: NP_031774
MGI: 103099
Ensembl: ENSMUSG00000041697
Vega: OTTMUSG00000014656
UniProt: P43024 Q9DCW5
Position
5 F; 5 56.06 cM
AA seq 111 aa
MASAVLSASRVSRPLGRALPGLRRPMSSGAHGEEGSARMWKALTYFVALPGVGVSMLNVF
LKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcgtcggcggtgctgtcagcgtctcgggtctctcggccgctgggccgggccctcccc
gggttgaggcggcccatgtcgagtggcgcccacggcgaggagggttcagctcggatgtgg
aaggccctcacctacttcgtggcgctgcccggggtgggagtgagcatgctcaacgtgttc
ctcaagtcgcggcacgaagagcacgagagacccccgttcgttgcctaccctcacctgcgc
atcaggaccaagcccttcccctggggagacggtaaccataccctcttccacaaccctcat
gtgaacccacttccgaccggctatgaagatgagtaa

KEGG   Mus musculus (mouse): 12862
Entry
12862             CDS       T01002                                 

Gene name
Cox6a2, COX, CoxVIaH, V, VIaH
Definition
(RefSeq) cytochrome c oxidase subunit 6A2
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12862 (Cox6a2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12862 (Cox6a2)
  09159 Environmental adaptation
   04714 Thermogenesis
    12862 (Cox6a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12862 (Cox6a2)
   05012 Parkinson disease
    12862 (Cox6a2)
   05014 Amyotrophic lateral sclerosis
    12862 (Cox6a2)
   05016 Huntington disease
    12862 (Cox6a2)
   05020 Prion disease
    12862 (Cox6a2)
   05022 Pathways of neurodegeneration - multiple diseases
    12862 (Cox6a2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12862 (Cox6a2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12862 (Cox6a2)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 12862
NCBI-ProteinID: NP_034073
MGI: 104649
Ensembl: ENSMUSG00000030785
Vega: OTTMUSG00000058671
UniProt: P43023
Position
7 F3; 7 70.04 cM
AA seq 97 aa
MALPLKVLSRSMASAAKGDHGGAGANTWRLLTFVLALPGVALCSLNCWMHAGHHERPEFI
PYHHLRIRTKPFAWGDGNHTLFHNPHVNPLPTGYEHP
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctctgcctctaaaggtcctgagccggagcatggccagcgcagccaaaggagaccat
ggaggggcaggagccaacacctggcgcctcctgacctttgtgctggctcttcccggcgta
gccctctgctcccttaactgctggatgcacgctggccaccacgagcgcccagagttcatc
ccgtatcaccacctccgcatccgaaccaagcccttcgcctggggggacggcaaccacacg
cttttccacaatccccacgtcaatcctttgcccaccggttatgagcacccttga

KEGG   Mus musculus (mouse): 12864
Entry
12864             CDS       T01002                                 

Gene name
Cox6c
Definition
(RefSeq) cytochrome c oxidase subunit 6C
  KO
K02268  cytochrome c oxidase subunit 6c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12864 (Cox6c)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12864 (Cox6c)
  09159 Environmental adaptation
   04714 Thermogenesis
    12864 (Cox6c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12864 (Cox6c)
   05012 Parkinson disease
    12864 (Cox6c)
   05014 Amyotrophic lateral sclerosis
    12864 (Cox6c)
   05016 Huntington disease
    12864 (Cox6c)
   05020 Prion disease
    12864 (Cox6c)
   05022 Pathways of neurodegeneration - multiple diseases
    12864 (Cox6c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12864 (Cox6c)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12864 (Cox6c)
SSDB
Motif
Pfam: COX6C
Other DBs
NCBI-GeneID: 12864
NCBI-ProteinID: NP_444301
MGI: 104614
Ensembl: ENSMUSG00000014313
Vega: OTTMUSG00000033854
UniProt: Q9CPQ1
Position
15; 15 B3.1
AA seq 76 aa
MSSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSM
KDFEEMRKAGIFQSAK
NT seq 231 nt   +upstreamnt  +downstreamnt
atgagttccggtgcgctgttgcccaaaccacagatgcgtggtcttctggccaagcgtctg
cgggttcatattgctggcgcattcattgtggccctgggagttgccgctgcctataagttt
ggcgtggctgagccaagaaagaaggcgtatgcagaattctacagaaattatgattccatg
aaagatttcgaagagatgaggaaggctggtatctttcagagtgccaagtga

KEGG   Mus musculus (mouse): 12865
Entry
12865             CDS       T01002                                 

Gene name
Cox7a1, COX, COX7, COX7A, COX7AH, COX7AM
Definition
(RefSeq) cytochrome c oxidase subunit 7A1
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12865 (Cox7a1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12865 (Cox7a1)
  09159 Environmental adaptation
   04714 Thermogenesis
    12865 (Cox7a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12865 (Cox7a1)
   05012 Parkinson disease
    12865 (Cox7a1)
   05014 Amyotrophic lateral sclerosis
    12865 (Cox7a1)
   05016 Huntington disease
    12865 (Cox7a1)
   05020 Prion disease
    12865 (Cox7a1)
   05022 Pathways of neurodegeneration - multiple diseases
    12865 (Cox7a1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12865 (Cox7a1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12865 (Cox7a1)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 12865
NCBI-ProteinID: NP_034074
MGI: 1316714
Ensembl: ENSMUSG00000074218
Vega: OTTMUSG00000059310
UniProt: P56392 Q792A4
Position
7 B1; 7 17.31 cM
AA seq 80 aa
MRALRVSQALVRSFSSSTRSHLENRVAEKQKLFQADNDLPVHLKGGGMDNVLYRLTMTLT
LGGTAYCLYCLGWASFPHKK
NT seq 243 nt   +upstreamnt  +downstreamnt
atgagggccctacgggtctcccaggctctggtccggtcttttagctcatctaccagaagc
cacttagaaaaccgtgtggcagagaagcagaagctcttccaggccgacaatgacctccca
gtacacttgaaaggcgggggaatggacaacgtcctgtacagactgaccatgacgctgact
ctggggggcactgcctactgcttatactgcttgggctgggcctccttcccccacaagaag
tga

KEGG   Mus musculus (mouse): 12866
Entry
12866             CDS       T01002                                 

Gene name
Cox7a2, COX, COX7AL, Cox7, Cox7a3, CoxVIIa-L
Definition
(RefSeq) cytochrome c oxidase subunit 7A2
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12866 (Cox7a2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12866 (Cox7a2)
  09159 Environmental adaptation
   04714 Thermogenesis
    12866 (Cox7a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12866 (Cox7a2)
   05012 Parkinson disease
    12866 (Cox7a2)
   05014 Amyotrophic lateral sclerosis
    12866 (Cox7a2)
   05016 Huntington disease
    12866 (Cox7a2)
   05020 Prion disease
    12866 (Cox7a2)
   05022 Pathways of neurodegeneration - multiple diseases
    12866 (Cox7a2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12866 (Cox7a2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12866 (Cox7a2)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 12866
NCBI-ProteinID: NP_034075
MGI: 1316715
Ensembl: ENSMUSG00000032330
Vega: OTTMUSG00000062962
UniProt: P48771
Position
9 E1; 9 43.82 cM
AA seq 83 aa
MLRNLLALRQIAQRTISTTSRRHFENKVPEKQKLFQEDNGMPVHLKGGASDALLYRATMA
LTLGGTAYAIYLLAMAAFPKKQN
NT seq 252 nt   +upstreamnt  +downstreamnt
atgttgcggaatctgctggcccttcgtcagattgcccagaggaccatcagcaccacttca
cgaaggcattttgaaaacaaggttccagagaaacaaaagctgtttcaggaggataatggg
atgccagttcatctgaaaggcggggcatctgatgccctcctctacagagccacaatggct
ctgacgcttggtggcacagcctatgccatctatctgttagctatggctgcatttcccaag
aagcagaactaa

KEGG   Mus musculus (mouse): 12867
Entry
12867             CDS       T01002                                 

Gene name
Cox7c, COX, COXVIIc, Cox7c1
Definition
(RefSeq) cytochrome c oxidase subunit 7C
  KO
K02272  cytochrome c oxidase subunit 7c
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12867 (Cox7c)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12867 (Cox7c)
  09159 Environmental adaptation
   04714 Thermogenesis
    12867 (Cox7c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12867 (Cox7c)
   05012 Parkinson disease
    12867 (Cox7c)
   05014 Amyotrophic lateral sclerosis
    12867 (Cox7c)
   05016 Huntington disease
    12867 (Cox7c)
   05020 Prion disease
    12867 (Cox7c)
   05022 Pathways of neurodegeneration - multiple diseases
    12867 (Cox7c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12867 (Cox7c)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12867 (Cox7c)
SSDB
Motif
Pfam: COX7C
Other DBs
NCBI-GeneID: 12867
NCBI-ProteinID: NP_031775
MGI: 103226
Ensembl: ENSMUSG00000017778
Vega: OTTMUSG00000032917
UniProt: P17665
Position
13; 13 C3
AA seq 63 aa
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLAMMTVYFGSGFAAPFFIVRHQL
LKK
NT seq 192 nt   +upstreamnt  +downstreamnt
atgttgggccagagtatccggaggttcacgacctccgtggtccgtcgcagccactatgag
gagggtccggggaagaatttgccattttcagtggaaaacaagtggcggttgctggctatg
atgaccgtgtactttggatctgggtttgccgcacctttctttatagtaagacaccagcta
cttaaaaaataa

KEGG   Mus musculus (mouse): 12868
Entry
12868             CDS       T01002                                 

Gene name
Cox8a, COX, COX8L
Definition
(RefSeq) cytochrome c oxidase subunit 8A
  KO
K02273  cytochrome c oxidase subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12868 (Cox8a)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12868 (Cox8a)
  09159 Environmental adaptation
   04714 Thermogenesis
    12868 (Cox8a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12868 (Cox8a)
   05012 Parkinson disease
    12868 (Cox8a)
   05014 Amyotrophic lateral sclerosis
    12868 (Cox8a)
   05016 Huntington disease
    12868 (Cox8a)
   05020 Prion disease
    12868 (Cox8a)
   05022 Pathways of neurodegeneration - multiple diseases
    12868 (Cox8a)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12868 (Cox8a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12868 (Cox8a)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 12868
NCBI-ProteinID: NP_031776
MGI: 105959
Ensembl: ENSMUSG00000035885
UniProt: Q64445
Position
19; 19 A
AA seq 69 aa
MSVLTPLLLRSLTGSARRLMVPRAQVHSKPAREQLGVLDITIGLTSCFVCCLLPAGWVLS
HLESYKKRE
NT seq 210 nt   +upstreamnt  +downstreamnt
atgtctgtcctgacgccactgctgctgaggagcctgaccggctcggcccggcggctcatg
gtgccgcgggctcaggtccactcgaagccggcgcgggagcagctcggggtcctggatatc
accattgggctcacttcctgcttcgtgtgttgtcttctgcctgcgggctgggtcctgtca
cacctggagagctacaagaagcgggagtga

KEGG   Mus musculus (mouse): 12869
Entry
12869             CDS       T01002                                 

Gene name
Cox8b, COX8, Cox8h, CoxVIII-H
Definition
(RefSeq) cytochrome c oxidase subunit 8B
  KO
K02273  cytochrome c oxidase subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12869 (Cox8b)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12869 (Cox8b)
  09159 Environmental adaptation
   04714 Thermogenesis
    12869 (Cox8b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12869 (Cox8b)
   05012 Parkinson disease
    12869 (Cox8b)
   05014 Amyotrophic lateral sclerosis
    12869 (Cox8b)
   05016 Huntington disease
    12869 (Cox8b)
   05020 Prion disease
    12869 (Cox8b)
   05022 Pathways of neurodegeneration - multiple diseases
    12869 (Cox8b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12869 (Cox8b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12869 (Cox8b)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 12869
NCBI-ProteinID: NP_031777
MGI: 105958
Ensembl: ENSMUSG00000025488
Vega: OTTMUSG00000060377
UniProt: P48772 Q545U6
Position
7 F5; 7 86.11 cM
AA seq 70 aa
MPRLPPILRLLQAPAKFTVVPKAHVSAKPAKTPTSAVEQAVGISAIVVGFMVPAGWVLAH
LESYKKSSAA
NT seq 213 nt   +upstreamnt  +downstreamnt
atgccaaggctcccccctatcctgcggctgctccaagcgcctgcgaagttcacagtggtt
cccaaagcccatgtctctgccaagccagccaaaactcccacttccgccgtggagcaggct
gtggggatctcagccatagtcgttggcttcatggttccagcaggatgggtcttagcccac
ttggagagctataaaaagagctccgcagcatga

KEGG   Mus musculus (mouse): 17708
Entry
17708             CDS       T01002                                 

Gene name
COX1, CoxI
Definition
(RefSeq) cytochrome c oxidase subunit I
  KO
K02256  cytochrome c oxidase subunit 1 [EC:7.1.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17708 (COX1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17708 (COX1)
  09159 Environmental adaptation
   04714 Thermogenesis
    17708 (COX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17708 (COX1)
   05012 Parkinson disease
    17708 (COX1)
   05014 Amyotrophic lateral sclerosis
    17708 (COX1)
   05016 Huntington disease
    17708 (COX1)
   05020 Prion disease
    17708 (COX1)
   05022 Pathways of neurodegeneration - multiple diseases
    17708 (COX1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17708 (COX1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17708 (COX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17708 (COX1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     17708 (COX1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    17708 (COX1)
SSDB
Motif
Pfam: COX1
Other DBs
NCBI-GeneID: 17708
NCBI-ProteinID: NP_904330
MGI: 102504
UniProt: P00397 Q9MD68
Position
MT
AA seq 514 aa
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPGALLGDDQIYNVIVTA
HAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQ
TPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLSN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFSGFTLDDTWAKAHFAIMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKR
EVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgttcattaatcgttgattattctcaaccaatcacaaagatatcggaaccctctatcta
ctattcggagcctgagcgggaatagtgggtactgcactaagtattttaattcgagcagaa
ttaggtcaaccaggtgcacttttaggagatgaccaaatttacaatgttatcgtaactgcc
catgcttttgttataattttcttcatagtaataccaataataattggaggctttggaaac
tgacttgtcccactaataatcggagccccagatatagcattcccacgaataaataatata
agtttttgactcctaccaccatcatttctccttctcctagcatcatcaatagtagaagca
ggagcaggaacaggatgaacagtctacccacctctagccggaaatctagcccatgcagga
gcatcagtagacctaacaattttctcccttcatttagctggagtgtcatctattttaggt
gcaattaattttattaccactattatcaacatgaaacccccagccataacacagtatcaa
actccactatttgtctgatccgtacttattacagccgtactgctcctattatcactacca
gtgctagccgcaggcattactatactactaacagaccgcaacctaaacacaactttcttt
gatcccgctggaggaggggacccaattctctaccagcatctgttctgattctttgggcac
ccagaagtttatattcttatcctcccaggatttggaattatttcacatgtagttacttac
tactccggaaaaaaagaacctttcggctatataggaatagtatgagcaataatgtctatt
ggctttctaggctttattgtatgagcccaccacatattcacagtaggattagatgtagac
acacgagcttactttacatcagccactataattatcgcaattcctaccggtgtcaaagta
tttagctgacttgcaaccctacacggaggtaatattaaatgatctccagctatactatga
gccttaggctttattttcttatttacagttggtggtctaaccggaattgttttatccaac
tcatcccttgacatcgtgcttcacgatacatactatgtagtagcccatttccactatgtt
ctatcaatgggagcagtgtttgctatcatagcaggatttgttcactgattcccattattt
tcaggcttcaccctagatgacacatgagcaaaagcccacttcgccatcatattcgtagga
gtaaacataacattcttccctcaacatttcctgggcctttcaggaataccacgacgctac
tcagactacccagatgcttacaccacatgaaacactgtctcttctataggatcatttatt
tcactaacagctgttctcatcatgatctttataatttgagaggcctttgcttcaaaacga
gaagtaatatcagtatcgtatgcttcaacaaatttagaatgacttcatggctgccctcca
ccatatcacacattcgaggaaccaacctatgtaaaagtaaaataa

KEGG   Mus musculus (mouse): 17709
Entry
17709             CDS       T01002                                 

Gene name
COX2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17709 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17709 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    17709 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17709 (COX2)
   05012 Parkinson disease
    17709 (COX2)
   05014 Amyotrophic lateral sclerosis
    17709 (COX2)
   05016 Huntington disease
    17709 (COX2)
   05020 Prion disease
    17709 (COX2)
   05022 Pathways of neurodegeneration - multiple diseases
    17709 (COX2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17709 (COX2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17709 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17709 (COX2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    17709 (COX2)
SSDB
Motif
Pfam: COX2 COX2_TM
Other DBs
NCBI-GeneID: 17709
NCBI-ProteinID: NP_904331
MGI: 102503
UniProt: P00405 Q7JCZ1
Position
MT
AA seq 227 aa
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS
YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
NT seq 684 nt   +upstreamnt  +downstreamnt
atggcctacccattccaacttggtctacaagacgccacatcccctattatagaagagcta
ataaatttccatgatcacacactaataattgttttcctaattagctccttagtcctctat
atcatctcgctaatattaacaacaaaactaacacatacaagcacaatagatgcacaagaa
gttgaaaccatttgaactattctaccagctgtaatccttatcataattgctctcccctct
ctacgcattctatatataatagacgaaatcaacaaccccgtattaaccgttaaaaccata
gggcaccaatgatactgaagctacgaatatactgactatgaagacctatgctttgattca
tatataatcccaacaaacgacctaaaacctggtgaactacgactgctagaagttgataac
cgagtcgttctgccaatagaacttccaatccgtatattaatttcatctgaagacgtcctc
cactcatgagcagtcccctccctaggacttaaaactgatgccatcccaggccgactaaat
caagcaacagtaacatcaaaccgaccagggttattctatggccaatgctctgaaatttgt
ggatctaaccatagctttatgcccattgtcctagaaatggttccactaaaatatttcgaa
aactgatctgcttcaataatttaa

KEGG   Mus musculus (mouse): 17710
Entry
17710             CDS       T01002                                 

Gene name
COX3
Definition
(RefSeq) cytochrome c oxidase subunit III
  KO
K02262  cytochrome c oxidase subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17710 (COX3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17710 (COX3)
  09159 Environmental adaptation
   04714 Thermogenesis
    17710 (COX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17710 (COX3)
   05012 Parkinson disease
    17710 (COX3)
   05014 Amyotrophic lateral sclerosis
    17710 (COX3)
   05016 Huntington disease
    17710 (COX3)
   05020 Prion disease
    17710 (COX3)
   05022 Pathways of neurodegeneration - multiple diseases
    17710 (COX3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17710 (COX3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17710 (COX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17710 (COX3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    17710 (COX3)
SSDB
Motif
Pfam: COX3
Other DBs
NCBI-GeneID: 17710
NCBI-ProteinID: NP_904334
MGI: 102502
UniProt: P00416 Q7JCX7
Position
MT
AA seq 261 aa
MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRD
VIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTG
ISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASE
YFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
NT seq 784 nt   +upstreamnt  +downstreamnt
atgacccaccaaactcatgcatatcacatagttaatccaagtccatgaccattaactgga
gccttttcagccctccttctaacatcaggtctagtaatatgatttcactataattcaatt
acactattaacccttggcctactcaccaatatcctcacaatatatcaatgatgacgagac
gtaattcgtgaaggaacctaccaaggccaccacactcctattgtacaaaaaggactacga
tatggtataattctattcatcgtctcggaagtatttttctttgcaggattcttctgagcg
ttctatcattctagcctcgtaccaacacatgatctaggaggctgctgacctccaacagga
atttcaccacttaaccctctagaagtcccactacttaatacttcagtacttctagcatca
ggtgtttcaattacatgagctcatcatagccttatagaaggtaaacgaaaccacataaat
caagccctactaattaccattatactaggactttacttcaccatcctccaagcttcagaa
tactttgaaacatcattctccatttcagatggtatctatggttctacattcttcatggct
actggattccatggactccatgtaattattggatcaacattccttattgtttgcctacta
cgacaactaaaatttcacttcacatcaaaacatcacttcggatttgaagccgcagcatga
tactgacattttgtagacgtagtctgacttttcctatacgtctccatttattgatgagga
tctt

KEGG   Mus musculus (mouse): 20463
Entry
20463             CDS       T01002                                 

Gene name
Cox7a2l, COX, COX7AR, COX7RP, EB1, SIG, SIG-, SIG-81, SIG81, Silg81
Definition
(RefSeq) cytochrome c oxidase subunit 7A2 like
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    20463 (Cox7a2l)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    20463 (Cox7a2l)
  09159 Environmental adaptation
   04714 Thermogenesis
    20463 (Cox7a2l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    20463 (Cox7a2l)
   05012 Parkinson disease
    20463 (Cox7a2l)
   05014 Amyotrophic lateral sclerosis
    20463 (Cox7a2l)
   05016 Huntington disease
    20463 (Cox7a2l)
   05020 Prion disease
    20463 (Cox7a2l)
   05022 Pathways of neurodegeneration - multiple diseases
    20463 (Cox7a2l)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    20463 (Cox7a2l)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    20463 (Cox7a2l)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 20463
NCBI-ProteinID: NP_033213
MGI: 106015
Ensembl: ENSMUSG00000024248
UniProt: Q61387 Q3UDK5
Position
17; 17 E4
AA seq 111 aa
MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPIIFATPTKLTSSVTAYDYSGKNKVP
ELQKFFQKADGFHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK
NT seq 336 nt   +upstreamnt  +downstreamnt
atgtactacaagtttagcagtttcacgcagaagttggctggagcttgggcttcggaagcc
tacaccccgcaggggttaaagccagtttccacagaagcaccacctatcatatttgccaca
ccaaccaaactgacctccagtgtgacagcatatgattattctgggaagaacaaagttcca
gagctgcagaagtttttccagaaggctgatggtttccacctgaaacgaggccttccagac
caaatgctttaccggaccaccatggctctgacactgggagggaccatctactgcctgatc
gccctctacatggcctcgcagcccagaaacaaatga

KEGG   Mus musculus (mouse): 333182
Entry
333182            CDS       T01002                                 

Gene name
Cox6b2, 1700067P11Rik, BC048670, COXV, COXVIB2
Definition
(RefSeq) cytochrome c oxidase subunit 6B2
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    333182 (Cox6b2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    333182 (Cox6b2)
  09159 Environmental adaptation
   04714 Thermogenesis
    333182 (Cox6b2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    333182 (Cox6b2)
   05012 Parkinson disease
    333182 (Cox6b2)
   05014 Amyotrophic lateral sclerosis
    333182 (Cox6b2)
   05016 Huntington disease
    333182 (Cox6b2)
   05020 Prion disease
    333182 (Cox6b2)
   05022 Pathways of neurodegeneration - multiple diseases
    333182 (Cox6b2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    333182 (Cox6b2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    333182 (Cox6b2)
SSDB
Motif
Pfam: COX6B CX9C
Other DBs
NCBI-GeneID: 333182
NCBI-ProteinID: NP_001276777
MGI: 3044182
Ensembl: ENSMUSG00000051811
Vega: OTTMUSG00000043341
UniProt: Q80ZN9 Q059Q8
Position
7; 7 A1
AA seq 88 aa
MLGVQAQKPPPGQWTTPPFDPRFPNQNQTRNCYQNFLDYHRCVKTMNRRGKSTQPCEYYF
RVFHSLCPISWVQRWNEQIKQGTFPGKI
NT seq 267 nt   +upstreamnt  +downstreamnt
atgttgggtgttcaagcccagaagccccctccgggccaatggacaacgccgccctttgat
ccgcgcttccctaaccagaaccagacgcgtaactgctaccagaattttctggactaccac
cggtgtgtgaagaccatgaatcgccgcggaaagagcacacaaccctgcgagtactatttc
cgtgtattccattcactgtgtcccatcagctgggtgcagcgctggaatgagcagatcaag
cagggaactttcccgggcaaaatatga

KEGG   Mus musculus (mouse): 66142
Entry
66142             CDS       T01002                                 

Gene name
Cox7b, 1110004F07Rik, C80563
Definition
(RefSeq) cytochrome c oxidase subunit 7B
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66142 (Cox7b)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    66142 (Cox7b)
  09159 Environmental adaptation
   04714 Thermogenesis
    66142 (Cox7b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66142 (Cox7b)
   05012 Parkinson disease
    66142 (Cox7b)
   05014 Amyotrophic lateral sclerosis
    66142 (Cox7b)
   05016 Huntington disease
    66142 (Cox7b)
   05020 Prion disease
    66142 (Cox7b)
   05022 Pathways of neurodegeneration - multiple diseases
    66142 (Cox7b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66142 (Cox7b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66142 (Cox7b)
SSDB
Motif
Pfam: COX7B DUF423 Deltameth_res
Other DBs
NCBI-GeneID: 66142
NCBI-ProteinID: NP_079655
MGI: 1913392
Ensembl: ENSMUSG00000031231
Vega: OTTMUSG00000018281
UniProt: P56393 Q5FW98
Position
X; X D
AA seq 80 aa
MLPLAKNALSRLQVRSIQQVVARQSHQKRAPSFHDKYGNAILAGGAIFCVSTWTYTATQI
GIEWNMSPVGRVTPKEWRDQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgttgcccttagccaaaaacgcactaagccgtctccaagttcgaagcattcagcaagtg
gtggcaaggcagagccaccagaagagggcacctagtttccatgacaaatatgggaatgct
atattagcaggtggagccatcttctgtgtttctacatggacatatacagccacacaaatt
ggaatagaatggaacatgtcccctgttggcagagtcaccccaaaggaatggagagatcag
tag

KEGG   Mus musculus (mouse): 75483
Entry
75483             CDS       T01002                                 

Gene name
Cox8c, 1700007F21Rik, COX8-, COX8-3, COXV, COXVIII-3
Definition
(RefSeq) cytochrome c oxidase subunit 8C
  KO
K02273  cytochrome c oxidase subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    75483 (Cox8c)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    75483 (Cox8c)
  09159 Environmental adaptation
   04714 Thermogenesis
    75483 (Cox8c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    75483 (Cox8c)
   05012 Parkinson disease
    75483 (Cox8c)
   05014 Amyotrophic lateral sclerosis
    75483 (Cox8c)
   05016 Huntington disease
    75483 (Cox8c)
   05020 Prion disease
    75483 (Cox8c)
   05022 Pathways of neurodegeneration - multiple diseases
    75483 (Cox8c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    75483 (Cox8c)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    75483 (Cox8c)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 75483
NCBI-ProteinID: NP_001034138
MGI: 1922733
Ensembl: ENSMUSG00000043319
UniProt: A6H666
Position
12; 12 E
AA seq 72 aa
MSRLLLLCSSLLRHRAVLFSKPGHPGRLSHSESPQKKILSPTESAVGIVVFFTTFYIPAA
YVLSSLKYFKGE
NT seq 219 nt   +upstreamnt  +downstreamnt
atgtctcgcctgctgctactctgctcttcgctcctccgccaccgtgcagtcctgttctcg
aagcctggccacccaggccgcctcagccactcagaaagcccacaaaaaaaaatcctgtcg
cccacggaatcagctgttgggattgtcgtgttttttacgaccttttacatcccagctgca
tatgtgctaagcagtctgaagtatttcaaaggagagtag

KEGG   Mus musculus (mouse): 78174
Entry
78174             CDS       T01002                                 

Gene name
Cox7b2, 4930503B16Rik
Definition
(RefSeq) cytochrome c oxidase subunit 7B2
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    78174 (Cox7b2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    78174 (Cox7b2)
  09159 Environmental adaptation
   04714 Thermogenesis
    78174 (Cox7b2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    78174 (Cox7b2)
   05012 Parkinson disease
    78174 (Cox7b2)
   05014 Amyotrophic lateral sclerosis
    78174 (Cox7b2)
   05016 Huntington disease
    78174 (Cox7b2)
   05020 Prion disease
    78174 (Cox7b2)
   05022 Pathways of neurodegeneration - multiple diseases
    78174 (Cox7b2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    78174 (Cox7b2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    78174 (Cox7b2)
SSDB
Motif
Pfam: COX7B KdpA Med12-PQL DUF4079
Other DBs
NCBI-GeneID: 78174
NCBI-ProteinID: NP_084328
MGI: 1925424
Ensembl: ENSMUSG00000049387
Vega: OTTMUSG00000054260
UniProt: Q9D2H1
Position
5; 5 C3.2
AA seq 82 aa
MMFPLARYALNYLKTPSILKIVGRLKHSKPSSEETHDKYGNMMLISGTIFCLAGYTIYMT
QMGVEWNLSPIGRVTPQEWKKK
NT seq 249 nt   +upstreamnt  +downstreamnt
atgatgtttcccttggccagatatgcactaaactatctcaagactccaagcattctgaaa
attgtgggaagactgaaacactcaaagccctcatcagaagaaactcatgacaaatacggc
aatatgatgctaattagtgggactattttctgtttagctggatatacaatttatatgaca
cagatgggtgtggagtggaacctgtctcctattggcagagttaccccccaagagtggaag
aagaagtaa

KEGG   Mus musculus (mouse): 84682
Entry
84682             CDS       T01002                                 

Gene name
Cox4i2, Cox4, Cox4b, CoxIV-2
Definition
(RefSeq) cytochrome c oxidase subunit 4I2
  KO
K02263  cytochrome c oxidase subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    84682 (Cox4i2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84682 (Cox4i2)
  09159 Environmental adaptation
   04714 Thermogenesis
    84682 (Cox4i2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84682 (Cox4i2)
   05012 Parkinson disease
    84682 (Cox4i2)
   05014 Amyotrophic lateral sclerosis
    84682 (Cox4i2)
   05016 Huntington disease
    84682 (Cox4i2)
   05020 Prion disease
    84682 (Cox4i2)
   05022 Pathways of neurodegeneration - multiple diseases
    84682 (Cox4i2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    84682 (Cox4i2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    84682 (Cox4i2)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 84682
NCBI-ProteinID: NP_444321
MGI: 2135755
Ensembl: ENSMUSG00000009876
Vega: OTTMUSG00000015832
UniProt: Q91W29
Position
2; 2 H1
AA seq 172 aa
MFSRAARSLVMRTGLRTRGTGTHSPGDAAGSQRRMTPYVDCYAQRSYPMPDEPFCTELSE
EQRALKEKEKGSWTQLSQAEKVALYRLQFHETFAEMNHRSNEWKTVMGCVFFFIGFTALV
IWWQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLAAHWDYEKKEWKK
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttttccagagctgcccggagtctggtaatgaggacaggactcagaactagagggaca
gggacacacagcccaggagatgctgctggcagccagaggaggatgaccccctacgttgac
tgctacgcccagcgctcctatcccatgccggatgagcccttctgcacagagctcagcgag
gagcagcgggccctgaaggagaaagagaagggcagctggacccagctgagccaagcagag
aaggtggccttgtaccggctccagttccatgaaaccttcgcagagatgaaccatcgctcc
aacgaatggaagacagtgatgggctgcgtcttcttcttcattggattcacggctctggtg
atttggtggcagcgagtctatgtgttccctaagaaggttgtcaccctgacggaagaacgg
aaagcccaacagctccagcgcctcctggacatgaagagcaaccccatacagggcctggct
gcccactgggattatgaaaagaaggagtggaaaaagtga

DBGET integrated database retrieval system