KEGG   Mus musculus (mouse): 110355
Entry
110355            CDS       T01002                                 

Gene name
Grk2, Adrb, Adrbk, Adrbk-1, Adrbk1, Bark, Bark-1, beta_ARK, betaA, betaARK1
Definition
(RefSeq) G protein-coupled receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04340  Hedgehog signaling pathway
mmu04724  Glutamatergic synapse
mmu04740  Olfactory transduction
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110355 (Grk2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110355 (Grk2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110355 (Grk2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110355 (Grk2)
  09157 Sensory system
   04740 Olfactory transduction
    110355 (Grk2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    110355 (Grk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    110355 (Grk2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110355 (Grk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     110355 (Grk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   110355 (Grk2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110355 (Grk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal DUF5647
Other DBs
NCBI-GeneID: 110355
NCBI-ProteinID: NP_001277747
MGI: 87940
Ensembl: ENSMUSG00000024858
Vega: OTTMUSG00000035343
UniProt: Q99MK8 Q3U1V3
Position
19 A; 19 3.98 cM
AA seq 689 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEAKPLVEFYEEIKKYEKLETEEERVVRSREIFDSYIMKELLAC
SHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKRPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIVHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLIQRGSANGL
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggccgacctggaggcggtgctggccgatgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgccagagcccagcatccgc
agcgtcatgcagaagtatctggaggaccgaggagaagtgacctttgaaaagatcttttcg
cagaagttagggtacctgcttttccgggacttctgcctgaaccatctggaagaggccaag
cccttggtggagttctacgaagagatcaagaaatatgagaagctggagacagaggaggaa
cgtgtggtccgcagccgagagatctttgactcctatattatgaaagaactgctggcctgc
tcacatcccttttcaaagaatgctacggagcatgtccagggccacctggtgaagaagcag
gtgcctccagatctcttccagccatacattgaggagatttgtcagaacctccgaggggac
gtgttccagaagttcatagagagtgacaagttcacacggttctgccagtggaagaatgtt
gagctcaacatccacctgaccatgaatgacttcagtgtgcatcgaatcatcgggcgtggg
ggcttcggtgaggtctatgggtgccggaaagcagacacaggcaagatgtacgccatgaag
tgtctggacaagaaacgcatcaagatgaagcagggagagaccctggctctgaacgagcgg
atcatgctttccctcgtcagcaccggggactgccccttcatcgtgtgcatgtcatatgca
ttccacacaccagacaagctcagcttcatcctggacctcatgaacggtggggacctgcac
taccacctgtctcagcatggagtcttctctgaagccgacatgcgcttctacgccgctgag
atcatcctgggccttgaacacatgcacaatcgctttgtagtctacagggacctgaagcca
gccaacattctcctggatgaacatggccatgtgagaatctcggacctgggcctagcctgt
gacttctccaagaagaggcctcatgccagtgtgggcacacacgggtacatggcccccgaa
gtcctacagaagggcgtggcctatgacagcagtgcagactggttctccctgggctgcatg
ctcttcaagttgttgcggggacacagccccttccggcagcacaagaccaaagacaagcat
gagattgaccgcatgacgttgacgatggctgtagagctgcctgactccttctcccctgaa
ctccgatccctgctggaaggtttgttgcagagggacgtcaatcggagactaggctgtctg
ggccgtggggctcaggaggtaaaagaaagtcctttctttcgttccctggactggcagatg
gtcttcttacagaagtaccctcctccactgatccccccacgtggggaggtgaatgcagct
gacgctttcgacattggctcctttgatgaggaggacacaaaaggaatcaagttactggac
agtgaccaggaactgtaccgcaacttccctctcaccatctctgagcggtggcaacaggag
gtggcagagactgtctttgataccatcaatgctgaaacagaccggctggaggcacgaaag
aaggccaaaaacaaacagctgggccacgaggaggactatgccctgggtaaggactgcatc
gtgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcgatac
ttctacttgttccccaaccggctcgagtggaggggtgaaggcgaggctccgcagagcctc
ctgaccatggaggagatccagtcagtggaagagacacagatcaaggaacgcaagtgtctc
ctgcttaagatccgaggtggcaagcagtttgtcctgcagtgtgatagtgatccagagctg
gtgcaatggaaaaaggagctgcgtgatgcctaccgcgaggcccagcagctggtacagcga
gtacccaagatgaagaacaagccacgctcgcctgtggtggagctgagcaaggtgccgctg
atccagcgtggcagtgccaacggcctctga

KEGG   Mus musculus (mouse): 14772
Entry
14772             CDS       T01002                                 

Gene name
Grk4, A830025H08Rik, GRK, Gpr, Gprk2l, Gprk4
Definition
(RefSeq) G protein-coupled receptor kinase 4
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14772 (Grk4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    14772 (Grk4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14772 (Grk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14772 (Grk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     14772 (Grk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   14772 (Grk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 14772
NCBI-ProteinID: NP_062370
MGI: 95801
Ensembl: ENSMUSG00000052783
Vega: OTTMUSG00000023169
UniProt: O70291
Position
5 B2; 5 17.91 cM
AA seq 574 aa
MELENFVANNLLLKARLGFNKQTGRSKKWRELLKFPPVSMCTELRWSIEKDFSSLCDKQP
IGRLLFRQFCDTKPDLKRCIEFLDAVAEYEVTIEEEQREFGLAIFSRFFKEKSEVPLPEI
PPDIVKECKWNLKQNSPSQNVFEECAGIVCKYLSETPFEEYQESTYFNRFLQWKWLERRP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRILEK
LHSRFVVSLAYTYETKDALCLVLTIMNGGDLKYHIYNLGDPGFEEPRAVFYAAELCCGLE
DLQRKRIVYRDLKPENILLDDHGHIRISDLGLAMEVPEGEMVRGRVGTVGYMAPEIINHE
KYTFSPDWWGLGCLIYEMIAGHSPFRKYKEKVNREELERRVKNETEEYSERFSEDAKSIC
SMLLIKDPSKRLGCQRDGVSAVKQHPIFKDINFSRLEANMLDPPFIPDPQAIYCRNILDI
GQFSVVKGVNLDTNDEIFYAEFATGSVTIPWQNEMIESGCFKDLNENEDDLSSLEKYKMC
SSILRPKRNFFRRLFRRTGCLNIALSEEREPTEH
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggaactcgagaacttcgtggccaacaatctgttgctgaaggcccgtctaggatttaac
aaacagactggtcgtagtaaaaaatggagagagctcctgaagtttcccccagtcagcatg
tgcactgaattaagatggtccatcgaaaaggattttagcagtctttgcgacaaacagcca
attggaagacttctttttagacaattctgtgatacaaaaccagatctaaaaaggtgcatt
gaattcttggatgcagtggcagagtacgaagttaccattgaagaggaacaaagagaattt
ggactagccatcttcagtagattcttcaaagagaagtcagaagtccccttaccagagata
cctccagatattgtgaaagagtgtaaatggaatctgaagcagaattctccctctcaaaat
gttttcgaagaatgtgctggaattgtctgtaagtatttgagtgaaacaccatttgaagaa
taccaagaaagtacctactttaatcgatttttacaatggaaatggctagaaaggcgtcca
gtaacaaagaacacattcagacaatatagagttctaggaaaaggcggatttggagaggtt
tgtgcctgtcaagtacgagctacaggaaaaatgtatgcctgcaaaaaactagaaaaaaaa
agaataaagaagaggaaaggtgaagccatggctctgaatgaaaaaagaatcttagaaaaa
ttgcatagtagatttgtagttagtttagcctacacttatgaaaccaaggatgctttgtgt
ttggtgctaaccataatgaatggaggggatttgaagtaccacatttacaacctgggtgat
cctggctttgaggagccgagagctgtgttctatgctgcagagctgtgctgtggcttggaa
gatttacagaggaaaagaattgtatacagagacctaaagccagagaatatcctccttgat
gatcatggacacatccgaatttcagatcttggtctagctatggaagtcccagaaggggag
atggtacgaggaagagttggtactgttggctacatggctccagaaattatcaatcatgaa
aagtatacatttagtcctgactggtggggacttggctgtttgatatatgaaatgattgcg
ggacattctccattcagaaaatataaagaaaaagtcaaccgggaggaattggaaagaaga
gtgaagaatgaaactgaggagtactctgagaggttttcagaggatgccaagtccatctgc
agcatgttactcatcaaagatccaagtaagagactgggctgccagagggatggagtctct
gctgtaaagcagcacccaatattcaaggatataaacttcagcaggctggaagcaaatatg
ttagatccacctttcattcctgatcctcaggccatttattgtaggaacatcttggatatt
gggcagttctctgtggtgaaaggagtcaacctggataccaatgatgaaatcttctacgct
gaatttgcgacagggtctgtcaccatcccctggcagaatgagatgattgaatctggatgt
ttcaaggatctcaatgaaaatgaagacgatttgtcatcacttgaaaaatacaagatgtgt
tcctccattctcagaccaaagagaaacttcttccgtagactcttcagaagaacgggctgc
ctgaacattgccctcagtgaggagagggagccaacagaacactga

KEGG   Mus musculus (mouse): 14773
Entry
14773             CDS       T01002                                 

Gene name
Grk5, Gpr, Gprk5
Definition
(RefSeq) G protein-coupled receptor kinase 5
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14773 (Grk5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    14773 (Grk5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14773 (Grk5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14773 (Grk5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     14773 (Grk5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   14773 (Grk5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal Sulfakinin
Other DBs
NCBI-GeneID: 14773
NCBI-ProteinID: NP_061357
MGI: 109161
Ensembl: ENSMUSG00000003228
UniProt: Q8VEB1 Q3TST4
Position
19 D3; 19 56.52 cM
AA seq 590 aa
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYYSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKEIMTKYLTPKSPVFIAQ
VGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSSKFSEEAKSIC
NMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLSPDLNRS
QPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHRINSNHINSNSTGSS
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgctgaaagcccgggaagggggtgga
ggaaagcgcaaagggaaaagcaagaagtggaaggaaatcctgaagtttcctcacatcagc
cagtgtgaagacctccgaaggaccatagacagagattactacagtctatgtgacaagcaa
ccaattgggagactgctttttcgacagttctgtgaaaccaggcctgggctggagtgctac
attcagttcctggacttagtggcagaatatgaaattactccagatgaaaaccttggggcg
aaggggaaggaaataatgaccaagtacctcactccaaagtccccagtcttcattgcccaa
gttggacaggacctggtctcccagacagagaagaagctcctgcagagcccctgcaaagaa
ctcttctctgcttgtgctcagtctgtccatgactacttgaagggagaccccttccacgag
tacctggatagcatgtattttgaccgttttctgcagtggaaatggttagaaagacaacca
gtgaccaaaaacactttccggcagtaccgagtgctgggcaaagggggctttggagaggtc
tgtgcctgccaggttcgggccactggtaaaatgtatgcttgtaaacgcttagagaagaag
aggatcaaaaagaggaaaggcgaatccatggcactcaacgaaaagcagattcttgagaag
gtcaacagccagtttgtggtcaacctggcctatgcctatgaaaccaaagatgcactatgc
ctggttctgaccattatgaatggtggtgacctgaagtttcacatctacaatatggggaat
cctggctttgaggaagagcgagccttattttatgcagctgagatcctctgtggcctagaa
gacttacaccgtgagaacactgtctatagagatctaaaacccgaaaacatcttgctggat
gattatggccacataaggatctcagacctcggactggccgtgaagatccccgagggagac
cttatccgtggccgggtaggcactgttggctacatggccccagaagttctgaacaaccag
cgatatggactgagccctgactactggggcctgggctgcctcatctatgagatgattgaa
ggccagtcaccatttcgaggtcgcaaggagaaggttaagcgggaagaggtggatcgccgg
gtgctggagactgaggaagtgtattcctccaagttctctgaagaggccaagtccatctgc
aacatgctgctcaccaaagactcgaagcagaggctgggctgccaggaggagggggccgcc
gaggtcaagaggcaccctttcttcaggaacatgaactttaagcgcctggaggctgggatg
ttggaccctcccttcgttccagatccccgggctgtatactgcaaggatgtgctggacatt
gagcagttctccactgtgaaaggtgtcaacctggaccatacggacgatgatttttactca
aagttctctacaggctctgtgccaattccatggcaaaatgagatgatagaaacagaatgt
ttcaaggagctgaatgtgttcggacctaacggtaccctctcaccagacctgaacagaagt
cagcctccagaaccgccaaagaaagggctgttccacagactcttcaggcgtcagcatcaa
agcaattccaagagttcacctactcctaagaccagttgtaaccaccgaataaattcaaac
cacatcaattcaaactccactggaagcagctag

KEGG   Mus musculus (mouse): 24013
Entry
24013             CDS       T01002                                 

Gene name
Grk1, Gprk1, R, Rh, Rhok, Rk
Definition
(RefSeq) G protein-coupled receptor kinase 1
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24013 (Grk1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    24013 (Grk1)
  09157 Sensory system
   04744 Phototransduction
    24013 (Grk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    24013 (Grk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     24013 (Grk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   24013 (Grk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like ABC1
Other DBs
NCBI-GeneID: 24013
NCBI-ProteinID: NP_036011
MGI: 1345146
Ensembl: ENSMUSG00000031450
Vega: OTTMUSG00000060906
UniProt: G3X905 Q4V9Z9
Position
8; 8 A1.1
AA seq 564 aa
MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLRLPPLSKCEGLRDNLSLEFES
LCSEQPIGKRLFQQFLKTDERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQGT
LFCNFLDQGMVTRVKEGPTGSQDGLFQPLLQATMEHLSQAPFQEYLESLYFLRFLQWKWL
EAQPIGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAIVEKR
ILTKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDVRYHIYNVDEDNPGFSEPRAIYYTAQ
IISGLEHLHQRRIVYRDLKPENVLLDNDGNIRISDLGLAVELKEGQNKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRIISEPVKYPEKFS
QASKDFCEQLLEKDPEKRLGFRDGTCDALRANVLFKDISWRQLEAGMLIPPFIPDSRTVY
AKNIQDVGAFSTVKGVVFDKADTEFFQEFASGNCSIPWQEEMIETGLFGDLNVWRADGQM
PDDMKGITTEEAAPTAKSGMCLIS
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggatttcgggtccttggagaccgtggtggccaactctgccttcatcgctgcccggggc
agttttgacggaagcagcacaccgtcttcccgagacaagaaatatctggccaagctccgg
ttgcccccactgtccaagtgtgagggtctccgtgacaacctcagcttggagtttgagagc
ctgtgctcagagcaacccatcggcaagaggctcttccaacagttcttgaagacagacgag
agacatgtgccagctctggagctctggaaggacattgaggactatgacactgctgatgat
gacctgaggccacagaaggcacaagccatcctggctgagtacctggacccacagggcaca
ctcttctgcaactttctggaccagggcatggtgacaagggtgaaagaagggccaactggg
agccaggacggcctcttccagcctttgctccaggccacaatggagcacttgagccaggcg
cccttccaggagtacctagaaagcttgtatttcctgcggtttcttcagtggaagtggttg
gaagcccagcccataggtgaagactggttcttggacttcagggtcctgggaaaggggggc
ttcggggaagtgtctgcctgtcagatgaaggcgactggcaagatgtatgcctgcaagaag
ctcaacaagaaacggctgaagaagaggaagggctaccagggcgccattgttgagaagagg
attctgactaaagtacacagcaggttcattgtgtctctggcctatgcgttcgagaccaag
acggacctctgtctggtgatgaccatcatgaacggaggtgacgtgaggtaccacatctac
aatgtggatgaggataaccccggcttctcagaaccacgggccatctattacacagcacag
atcatcagtggcctggagcacctgcatcagagacgcattgtctaccgtgacctcaagcca
gagaatgtgctattggacaatgatggcaatatccgaatttctgaccttggactggctgtg
gagctgaaggaagggcagaataagaccaagggctacgcagggaccccaggtttcatggcc
cctgagctcctgcgaggtgaagaatacgacttctctgtggactactttgccctgggggtc
acattgtacgagatgatcgcagccagaggacccttccgagcccgaggagagaaggtagag
aacaaggagcttaagcaacgtatcatctcagagcctgtgaagtacccagagaagttcagc
caggccagcaaggacttctgtgagcagctgttggagaaggacccggagaagcgcctgggc
ttccgggatggaacctgtgatgcgcttcgggcaaacgtcctcttcaaagatatcagctgg
aggcagctcgaagccgggatgctcattcctccattcatcccagactctaggactgtctat
gccaagaacattcaggacgtgggtgccttttccacagtcaagggtgtggtttttgacaaa
gcggacacagagttcttccaagaattcgcctctggcaactgctccattccctggcaggag
gagatgatcgagactgggctctttggggacctaaatgtgtggcgcgcagatggtcagatg
ccggatgacatgaagggaatcaccacggaggaggcagcccctacagccaagtcgggaatg
tgtctcatctcctag

KEGG   Mus musculus (mouse): 26385
Entry
26385             CDS       T01002                                 

Gene name
Grk6, Gpr, Gprk6
Definition
(RefSeq) G protein-coupled receptor kinase 6
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    26385 (Grk6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    26385 (Grk6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    26385 (Grk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26385 (Grk6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     26385 (Grk6)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   26385 (Grk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 26385
NCBI-ProteinID: NP_001106182
MGI: 1347078
Ensembl: ENSMUSG00000074886
UniProt: O70293
Position
13 B1; 13 30.06 cM
AA seq 576 aa
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVSEYEVTPDEKRKACGRRLMQNFLSHTGPDLIPE
VPRQLVSNCAQRLEQGPCKDLFQELTRLTHEYLSTAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVRNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYTDRFSSQARSLC
SQLLSKDPAERLGCRGGGAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVDLEPTDQDFYQKFATGSVSIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPTAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggagctcgagaacatcgtagcgaacacggtgctactcaaggcccgggaaggtggtggc
gggaatcgcaaaggcaagagcaagaaatggcgccagatgctgcagttcccccatatcagc
cagtgtgaggagcttcgactcagccttgagcgtgactaccacagcctatgtgagcgccag
cccattgggcgcctgttatttcgtgagttctgtgctacgagacctgagctgacccggtgt
actgccttcctggatggggtgtctgaatatgaggtgacccctgatgagaagcggaaagca
tgtgggcgccgactaatgcagaactttctgagccacacgggtcctgacctcatccctgaa
gttccacggcagctggtgagtaactgtgcccagcggctagagcagggaccctgcaaagac
ctcttccaggagctgacccggctgacccacgagtacctgagcacggccccttttgccgac
tacctcgacagcatctacttcaaccgttttctgcagtggaagtggctggaaaggcaacca
gtgaccaaaaacaccttcaggcagtaccgagtcctgggcaaaggtggctttggggaggta
tgtgcctgccaggtgcgggcaacaggcaagatgtacgcatgcaagaaactggaaaagaag
cggataaagaagcgaaagggggaggccatggctctcaacgagaaacagatcttggagaaa
gtgaacagtaggtttgtagtgagcttagcctacgcctatgagaccaaggatgcactgtgc
ctggtgctgacattgatgaatggaggtgacctaaagttccacatctaccacatgggccag
gctggctttcctgaagcacgtgctgtcttctatgctgctgagatctgctgtggcctggaa
gacctgcaccgggaacgcattgtgtacagggatctaaagccagagaatatccttctggat
gaccatggccacattcggatctcggacctgggactggccgtgcatgtgcctgagggccag
accatcaaaggccgtgtgggcactgtgggctacatggctccagaggtggtgaggaatgag
cgctacacgttcagtcctgactggtgggcgctaggctgcctcctgtacgagatgatcgca
ggtcagtcgcccttccagcagaggaagaagaagataaagcgcgaagaggtggagcggctg
gtcaaggaagtggccgaggagtacacagaccgcttttcctcacaggcgcgctcactctgt
tctcagcttcttagcaaggaccctgctgagcgcctggggtgtcgtggaggtggcgcccgt
gaggtaaaggagcacccccttttcaagaaactgaatttcaagcggctgggagctggcatg
ctagagccaccttttaagcctgatccccaggctatttattgcaaggatgtcctggacatt
gaacagttctctacagttaaaggtgtggatctggagcccacagaccaagacttctaccag
aagtttgccacaggcagtgtgtccatcccctggcagaatgagatggtggagaccgagtgc
ttccaggaactcaatgtctttgggctggatgggtctgttcccccagacctggactggaag
ggccagcccactgcaccccccaagaagggattgctacagagactcttcagtcgccaagat
tgctgtgggaactgcagcgacagtgaggaagagctccccacccgcctctag

KEGG   Mus musculus (mouse): 320129
Entry
320129            CDS       T01002                                 

Gene name
Grk3, 4833444A01Rik, AI851927, AW551196, Adrb, Adrbk, Adrbk-2, Adrbk2, Bark, Bark-2
Definition
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04340  Hedgehog signaling pathway
mmu04724  Glutamatergic synapse
mmu04740  Olfactory transduction
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    320129 (Grk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    320129 (Grk3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    320129 (Grk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    320129 (Grk3)
  09157 Sensory system
   04740 Olfactory transduction
    320129 (Grk3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    320129 (Grk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    320129 (Grk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    320129 (Grk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     320129 (Grk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   320129 (Grk3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   320129 (Grk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 320129
NCBI-ProteinID: NP_796052
MGI: 87941
Ensembl: ENSMUSG00000042249
Vega: OTTMUSG00000054354
UniProt: Q3UYH7 Q8BVT9
Position
5 F; 5 55.29 cM
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKTAPAARASKKVVLPEPSIRSVMQRYLAERNEITFDKIFN
QKIGFLLFKDFCLNEIGEAVPQVKFYEEIKEYEKLDNEEDRLRRSRQMYDAYIMRELLSS
THQFSKQAVEHVQSHLSKKQVTATLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLSMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRVKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDMHYHLSQHGVFSEKEMRFYASE
IILGLEHMHTCFVVYRDLKPANILLDEYGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTCYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVQLPDAFSPE
LRSLLEGLLQRDVSQRLGCGGGGARELKEHIFFKGIDWQHVYLRKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLVISERWQQEVVETIYDAVNADTDKIEARR
KAKNKQLGQEEDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQSL
LTMEQIMSVEETQIKDRKCILLRIKGGKQFVLQCESDPEFAQWLKELTCTFNEAQRLLRR
APKFLNKPRAAILEFSKPPLCHRNSSGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgacgtcagctacctgatggccatggagaagagc
aagacggcgccggccgcgcgcgccagcaagaaggtcgtcctgccggagcccagtatccgg
agtgtgatgcagaggtatctggcagagagaaacgaaataacctttgacaagattttcaat
cagaaaatcggcttcctactatttaaagacttctgcttgaatgaaattggggaagcagtg
cctcaggtgaaattttatgaagagataaaagaatatgagaagctggacaacgaagaggat
aggctacgccggagccggcagatgtacgacgcctacatcatgagggagctcctatccagc
acacaccaattctcaaagcaagctgtagaacatgtccagagccatctctccaagaaacag
gtgacggctacacttttccagccatacatagaagaaatctgtgaaagccttcgtggggat
attttccaaaagtttatggaaagcgataaattcactagattctgtcagtggaagaacgtg
gagttgaatattcacctgagcatgaacgacttcagtgtgcacaggatcatcggccgagga
gggtttggggaagtttatggctgcaggaaagcagacaccggtaaaatgtatgccatgaag
tgcttagacaagaaaagggtgaagatgaagcagggggagactctggctttgaacgagagg
atcatgctgtctctcgttagcactggggattgtccctttattgtctgcatgacctacgcc
ttccacacgccggacaaactctgcttcatcctggacctgatgaacgggggcgacatgcac
taccatctctctcaacacggggtgttttctgagaaggagatgcggttttatgccagcgag
atcatcctgggcctcgagcacatgcacacctgcttcgtagtctacagagacctgaagcct
gcgaacatcctcctagatgaatatgggcacgtgaggatatcggatctcggccttgcctgc
gatttctccaaaaagaagcctcatgccagcgtgggcacccatgggtacatggctcccgag
gtgttgcagaagggaacgtgctatgacagcagcgccgactggttctccctgggctgtatg
ctcttcaagcttctgcggggccacagccccttcaggcagcataaaaccaaagacaagcat
gagatagaccgaatgaccctgaccgtgaacgtgcagcttccagatgccttctcccctgag
ctgaggtccctcttagagggtttgctccagcgggacgtgagccagcggctgggctgcgga
ggaggaggggcacgagagttgaaggagcacatcttcttcaagggcattgactggcagcat
gtgtacttacggaagtacccgccacccctaatccctcctcggggagaggtcaacgctgca
gatgccttcgatatcggctccttcgatgaggaagacaccaaaggcattaagctgttggac
tgtgaccaggacctctataagaacttcccactggtgatctccgagcgctggcagcaagaa
gtggtggagaccatctatgacgccgtcaatgctgatactgataaaatcgaggccaggagg
aaggctaaaaataagcaacttggtcaagaggaagattacgctatggggaaggactgcatc
atgcacgggtacatgctgaagctggggaacccctttctcacacagtggcaaagacgctat
ttttacctgttccccaacagactggagtggagaggagagggcgagtctcggcaaagtcta
ctgaccatggaacagatcatgtctgtggaggagacccagattaaagacagaaagtgcatc
ttactcaggataaagggagggaagcaatttgtcttgcaatgtgagagtgaccccgagttt
gcacagtggctgaaggagctgacctgcaccttcaatgaggcccagagactgctgcgccgt
gcccccaaattcctcaacaaaccacgggccgccatcctggagttctccaagccaccactg
tgtcacagaaatagcagcggcctctga

DBGET integrated database retrieval system