KEGG   Mus musculus (mouse): 110379
Entry
110379            CDS       T01002                                 

Gene name
Sec13, 1110003H02Rik, Sec1, Sec13l1, Sec13r
Definition
(RefSeq) SEC13 homolog, nuclear pore and COPII coat complex component
  KO
K14004  protein transport protein SEC13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu04141  Protein processing in endoplasmic reticulum
mmu04150  mTOR signaling pathway
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110379 (Sec13)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110379 (Sec13)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    110379 (Sec13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110379 (Sec13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    110379 (Sec13)
   04131 Membrane trafficking [BR:mmu04131]
    110379 (Sec13)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     110379 (Sec13)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    110379 (Sec13)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    110379 (Sec13)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 110379
NCBI-ProteinID: NP_077168
MGI: 99832
Ensembl: ENSMUSG00000030298
Vega: OTTMUSG00000023506
UniProt: Q9D1M0
Position
6 E3; 6 52.84 cM
AA seq 322 aa
MVSVMNTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPV
WQVAWAHPMYGNILASCSYDRKVIIWKEENGTWEKTHEHSGHDSSVNSVCWAPHDYGLIL
ACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDQPSGQKPNYIK
KFASGGCDNLIKLWREEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
FIWTCDDASGNMWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCI
SDVNKGQGSVSASITEGQQNEQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtgtcagtaatgaacactgtggacacctctcatgaggacatgattcatgatgcacag
atggactactacggcacccgcctagcaacctgctcctcggataggtccgtcaaaattttc
gatgtgcggaatggagggcagatcctcatcgcagacctcagaggacatgaggggccagta
tggcaagtggcctgggcccaccccatgtatggcaatatcctggcctcctgttcctatgac
cggaaagtcatcatctggaaggaggaaaacggcacttgggagaagacccatgagcactcg
ggacacgactcctcagtgaactctgtttgctgggcccctcatgactatggcctgatcctg
gcctgtgggagttcagatggggccatctcactgctgacctatacaggggaaggccagtgg
gaagtgaagaagattaacaatgctcacacgattggctgtaatgctgtcagttgggcccca
gcagttgtgcctggaagccttatagaccaaccatcagggcagaaacccaattacatcaag
aagtttgcatcaggtggctgtgacaacctcatcaagctatggagggaagaggaggatggc
cagtggaaggaggagcagaagctagaggcacacagcgactgggtccgagatgttgcctgg
gccccctccattggcttgcccaccagcaccattgccagctgctctcaggatggtcgagtg
tttatttggacctgtgacgatgcctcaggcaatatgtggtcacctaaactcctacacaag
ttcaatgatgttgtgtggcacgtgagctggtccatcacagccaacatcctggctgtgtca
ggtggagacaataaggtgaccctgtggaaagagtcggtggacggacagtgggtgtgcatc
agtgacgtcaacaagggccagggttctgtgtcagcctccatcacagagggccaacagaac
gagcagtga

KEGG   Mus musculus (mouse): 240667
Entry
240667            CDS       T01002                                 

Gene name
Sec31b, Gm341, Sec31, Sec31l2
Definition
(RefSeq) Sec31 homolog B (S. cerevisiae)
  KO
K14005  protein transport protein SEC31
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    240667 (Sec31b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    240667 (Sec31b)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    240667 (Sec31b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    240667 (Sec31b)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   240667 (Sec31b)
SSDB
Motif
Pfam: Sec16_C WD40 SRA1
Other DBs
NCBI-GeneID: 240667
NCBI-ProteinID: NP_001028515
MGI: 2685187
Ensembl: ENSMUSG00000051984
Vega: OTTMUSG00000036224
UniProt: Q3TZ89
Position
19; 19 C3
AA seq 1158 aa
MKLKELEKPAVQAWSPARQYPVYLATGTSAQQLDASFSTNATLEIFEIDFRDPSLDLKHK
GILSVSSRFHKLIWGSFGSGLLENSGVIAGGGDNGTLTLYNVTHVLSSGKEPLIAQKQKH
TGAVRALDFNPFQGNLLASGASDSEIFIWDLNHLSVPMTPGPKSQNPPEDIKALSWNLQV
QHILASAHPSGKAVVWDLRKNEPIIKVSSHSSRMNCSGLAWNPDIATQLVLCSEDDQLPV
IQLWDLRFASSPLKVLESHSRGILSMSWNQADAELLLSTAKDSQIFCWNLSSSEVVYKLP
TQSSWCFDVQWCPQSPPVFSAVSFDGWISLCSVMGRSWEAQHMRQADKVPEQVAQASLIP
PLKKPPKWMRRPAGGSFAFGGKLVTFGLPSIPVQPVAQACSRPVFISQVITESEVLTRSV
VLQEALGSGNLLNYCQSKVQQASLPCEKILWQFLKVTLEQDSRPKFLGLLGYSREELQKK
VDTCLKSDSKSQESPQLEAVDLKSDRAHSPCAQASKHTAKEASESSAFFDELIPQNMTPW
EIPTTEDTDGLLSQALLLGELRSAVELCLKEERFADAIILAQAGDAELLKWTQERYLAKR
RTKTSSLLACVVKKNWKDLVCACRLKNWREALALLLTYSGPEKFPELCDMLGTRMEQEGG
RALTSEARLCYVCSGSVERLVESWAKFQQASSPMALQELMEQVTVLSRSLELLQGSNKMS
PGPATTHRLTQYANLLAAQGSLATAMSFLPSDCIQPGVQQLRDRLFHAQGSAVLGQQAPA
FPFPRVAVGAALHSKETSSYRRGLQPPQQVPAPSVRPRTTAQPSSVMPFSPSQPSPSQGS
SDHRVLRPQAILPGHFVPGVRPALSPPQLSGGQSVPAVNPAGFCGAWPLPGPTPVMASPD
FMQPGSTHLPETPRLLPLPPVGPPGPNPLSSQLPASPVTFSVAPPPGGPRAPCSSALPSS
GILATCPGPQDSWKVSPASQGNLQRKKLPETFMPPAPITAPLRSLGPEPQQALLPQPLVS
SATLPPPGAPRECSLQQLQPLPPERTEKELPPEHQCVKDSFEALLQRCSLTATDLKTKRK
LEEAARRLECLYEKLCEGTLSPHVLAGLHEVARCVDAGSFEQGLAVHAQVAGCSSFSEVS
SFMPMLKAVLTIAHKLQG
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgaagttgaaagaacttgagaagccagctgtccaagcgtggagcccggccaggcagtac
cctgtgtatctggccacaggaacatctgctcagcaactagatgcctcctttagcacaaat
gccaccctggaaatatttgagattgatttcagggacccttctctggacttgaaacacaaa
ggaattctttctgtctccagcaggtttcacaagctaatatggggaagctttggcagtggg
cttctggaaaactccggggttattgctggtggaggagacaacggcacactgactctatac
aatgtgacccacgtcctttcttcagggaaggagcccctgattgcccagaaacagaagcac
actggagctgtcagagccttggactttaatcctttccagggcaatctcctggcctcagga
gccagtgactctgagatcttcatttgggatttgaaccacctgagtgtcccaatgacacct
ggacccaagtcacagaaccccccagaggacatcaaggcattgtcttggaacctccaagtc
cagcacatcctggcttccgctcaccccagcggcaaggcggtggtgtgggatctcagaaag
aatgagcccatcattaaagtcagcagccacagcagcaggatgaactgctcgggcctggcc
tggaacccagacatagccactcagttagtgctgtgctcagaagacgaccaactcccggtg
attcagttgtgggacctgcgcttcgcttcgtcacccttgaaggtgctggagagccacagc
aggggcatcttgtcgatgtcctggaaccaggccgatgccgaactgctgcttagcactgcc
aaagacagccagatcttttgctggaacctgtcaagcagtgaggtggtctacaagctgccc
acacagagcagctggtgctttgatgttcagtggtgccctcagagccctcccgtgttctct
gctgtctccttcgatggctggatcagtttgtgctctgtgatgggtaggagctgggaagcc
cagcacatgaggcaggctgacaaggtgcctgagcaggtggcccaagcatcactcatccct
cccttgaagaagcctcccaagtggatgcgaaggccggcaggcggttcatttgcttttggg
ggaaagctggttacttttggccttcccagcatccctgtccagccagtggcacaggcttgt
tcccgccctgtcttcatcagtcaagtcatcacagagtcagaagtcctgactcggtcagtt
gtgctgcaggaggccttgggatctggaaatctccttaattattgtcagagcaaggttcag
caagcatcactgccatgcgagaagatactctggcagttcctgaaggtgaccttagagcag
gattccaggccgaagttccttgggctgttaggttacagcagagaggaacttcagaagaag
gtggacacttgcctgaagagtgactcaaaatcacaggaaagccctcagcttgaggcggtt
gacctcaaaagtgacagagcacacagcccttgcgcccaggcctccaaacacactgccaag
gaagcctctgagtcctcagccttctttgatgagctgatacctcagaacatgactccctgg
gagatccccaccacagaagacactgatggactcctgagccaggctctgctgctcggggaa
ctgcggtctgctgtggagctgtgtttgaaggaggaacgctttgctgatgccatcatcctg
gctcaggctggggatgcagagctgctcaagtggacacaagaacgctacctagccaagagg
agaaccaaaacctcctcgcttctagcctgtgttgtaaagaagaattggaaggacctagta
tgtgcctgtaggctgaagaactggagagaggcgctggccttgctactgacgtattcaggg
ccagagaagttccctgagctctgtgacatgctgggaactcgaatggagcaggagggaggc
agggcactcacctctgaagccagactctgctacgtgtgctcagggagtgtggagcggctg
gtagagagctgggcaaaattccagcaagcctcgagccccatggctctgcaggagctaatg
gagcaggtgacagtcctcagcaggagcctggagctccttcagggctctaacaagatgagc
ccaggtcctgccacaacacacaggctcacccagtatgccaatctcctggcagcccagggc
agcctagccactgctatgagcttcctacccagcgactgtatccagccaggagttcagcag
ctgagagatcggctttttcatgcccaaggttctgccgtcttaggccaacaggctcctgct
ttccctttcccccgagttgctgtaggagctgccctccactccaaagagacatcgtcatac
agaagggggctccagcctcctcagcaggtcccagctccatctgtgaggccgaggaccaca
gctcagccgtcatcagtgatgcccttcagcccctcccagcccagcccttctcagggctca
agtgaccacagggtccttaggccccaggcaatcctgcctgggcatttcgtccctggagta
aggcctgctttatctccgccacagctgtccggaggacaaagtgttccagctgtaaaccca
gctggattctgtggcgcatggcctcttcctggccccactccagtcatggcgtccccagac
ttcatgcagcccggctctacccatctgcctgaaactcctagactcctccctctgcctcct
gtgggaccaccaggtcccaaccctctgagctcccagctcccagcctctcctgtcactttc
tctgtggctccccctcctggaggtccaagagcaccgtgctctagtgcactcccgagctct
ggcatcttggccacttgtccaggaccccaggactcctggaaagtttctccagcctcccag
ggaaacctccaaaggaaaaagctgcctgagacattcatgcctccagcaccaattacagct
ccgcttaggagccttggccctgagccacaacaggccctgctacctcagcccctagtctcc
agtgcgaccctgcctcctcctggagccccaagagaatgcagcctgcagcaactccagcca
ctgcctcctgagaggacagagaaggagctgcccccagagcatcagtgcgtgaaggacagc
tttgaggcactccttcagcgctgttccctgaccgccactgaccttaaaacaaaaaggaag
ctggaggaggcagcccgccgcctagaatgtctgtatgagaagctttgcgaggggacactc
tcgccccacgtcctggctgggctccatgaagttgcccgatgtgtggatgccggaagcttt
gagcagggcctcgcggtgcatgcgcaggtggcgggctgcagcagcttcagcgaggtatcc
agcttcatgcctatgctgaaggccgtcctcaccatcgcgcacaagctgcagggctaa

KEGG   Mus musculus (mouse): 69162
Entry
69162             CDS       T01002                                 

Gene name
Sec31a, 1810024J13Rik, ABP125, ABP130, AU042160, HSPC275, Sec31, Sec31l1
Definition
(RefSeq) Sec31 homolog A (S. cerevisiae)
  KO
K14005  protein transport protein SEC31
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    69162 (Sec31a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69162 (Sec31a)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    69162 (Sec31a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    69162 (Sec31a)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   69162 (Sec31a)
SSDB
Motif
Pfam: Sec16_C SRA1 Prp18
Other DBs
NCBI-GeneID: 69162
NCBI-ProteinID: NP_081245
MGI: 1916412
Ensembl: ENSMUSG00000035325
Vega: OTTMUSG00000043627
UniProt: Q3UPL0
Position
5; 5 E4
AA seq 1230 aa
MKLKEIDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPHKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQKDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
IQMWDLRFASSPLRVLENHARGILAVAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSIDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQSAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFESVAVPLQQGAEQ
QRRQPVFISQVVTEKDFLNRSAQLQHAVQSQGFIGYCQKKIEASQTEFEKNVWSFLKVNF
EEDSRGKYLELLGYRKEDLGQKIALALNKVDGPDVALKDSDQVAQSDGEESPAAEEQLLG
ERIKEEKQECDFLPSAGGTFNISVSGDIDGLITRALLTGNFESAVDLCLHDNRMADAIIL
AIAGGQELLAQTQKKYFAKSQSKITRLITAVVMKNWREIVESCDLKNWREALAAVLTYAK
PDEFSALCDLLGTRLEREGDSLLRTQACLCYICAGNVERLVACWTKAQDGSSPLSLQDLI
EKVVILRKAVQLTQALDTNTVGALLAEKMSQYASLLAAQGSIAAALAFLPDNTNQPNIVQ
LRDRLCKAQGKPVSGQESSQSPYERQPLSKGRPGPVAGHSQMPRVQTQQYYPHGENPPPP
GFIMQGNVIPNPAAPLPTAPGHMPSQLPPYPQPQPYQPAQQYSFGTGGAAAYRPQQPVAP
PASNAYPNTPYISPVASYSGQPQMYTAQQASSPTSSSAASFPPPSSGASFQHGGPGAPPS
SSAYALPPGTTGTPPAASELPASQRTENQSFQDQASILEGPQNGWNDPPALNRVPKKKKM
PENFMPPVPITSPIMNPSGDPQSQGLQQQPSTPGPLSSHASFPQQHLAGGQPFHGVQQPL
AQTGMPPSFSKPNTEGAPGAPIGNTIQHVQALPTEKITKKPIPEEHLILKTTFEDLIQRC
LSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTIINGLHSIARSIETRNYSEGLSVHT
HIVSTSNFSETSAFMPVLKVVLSQASKLGV
NT seq 3693 nt   +upstreamnt  +downstreamnt
atgaagttaaaggagatagatcgtacagctatgcaggcatggagccctgcccagaaccac
cccatttacctagccacaggaacatccgctcagcagttggatgcgacgtttagtaccaat
gcttccctcgagatattcgagctggacctttcggacccatccttggatatgaagtcttgt
gctacgttctcctcttctcacaggtaccacaagttgatctggggacctcataagatggat
tccaaaggagatgtttctggagttctgattgcaggtggagaaaatggaaacattattctt
tatgatccttctaaaattatagctggagacaaggaagttgtgattgcccaaaaggacaag
catactgggccagtgagagccttggatgtgaacatcttccagaccaatttggtggcctct
ggtgctaatgaatctgaaatctacatttgggatctaaacaattttgcaactccaatgacg
ccgggagctaaaacacagccaccagaagatatcagctgcatagcatggaacagacaagtt
cagcatatcttagcatcagccagtcccagtggccgggcaactgtctgggatctcaggaaa
aacgagcctatcatcaaagtcagtgaccacagtaacaggatgcattgctctgggctggcg
tggcaccctgatgtggctactcagatggtcctcgcctctgaggatgatcgattaccagtg
atccagatgtgggaccttcgatttgcctcctctcctctccgggttctggaaaatcatgcc
agggggattttggcagttgcttggagcatggcagatcctgagttgttgttaagctgtgga
aaagatgctaagattctctgctctaaccctaacacaggagaggtattatatgaacttccc
accaacacacagtggtgctttgatatccagtggtgtcctcgaaatcctgctgtcctgtcc
gctgcttcctttgatggacggatcagtgtctattccatcatgggagggagcatagacggc
ttacggcagaaacaagttgacaagctttcatcatcttttgggaatcttgatcctttcggc
acaggacagcctctccctccattacaaatcccacagcagagcgctcagcacagcatagtg
ctgcccctgaagaagcctcccaagtggatccggaggcctgtgggcgcttccttctcgttt
ggagggaagttggtgacttttgagagcgttgcagtgccgctgcagcagggagctgagcag
cagcgacggcagcctgtgttcatcagtcaggtggtgacggagaaggactttctcaaccgg
tcggcgcagctgcagcatgctgtgcagtctcagggcttcatcggttactgccagaaaaag
atcgaggcttcccagaccgagtttgagaaaaatgtgtggtccttcttgaaggtaaacttt
gaggaggattctcgtggaaaataccttgagcttctgggatacagaaaggaagatctgggg
cagaagattgctttggccttgaacaaagtggacggacccgatgtggctcttaaggactct
gaccaagtagcgcagagtgatggggaggagagtcctgctgctgaagagcagctcttggga
gagcgcattaaagaggaaaaacaggaatgtgactttctgccctcggcgggagggacgttt
aacatctctgtcagtggggatattgacggtctaattacccgggccttgctgacaggcaat
tttgagagtgcagttgacctttgcttacatgataaccgaatggctgatgccattatatta
gccatagcaggtggacaggaactcttggctcaaacacaaaagaaatacttcgcaaaatcc
caaagcaaaattaccaggcttatcactgcagtggtgatgaagaactggagggagattgtt
gaatcctgtgatcttaagaattggagagaggctttagctgcagtcctcacttacgctaaa
ccagacgagttctcggccctgtgcgatctcctgggaacccgtctggaaagagaaggagac
agcctcctgcggactcaggcctgcctctgctacatctgtgcagggaatgtagagagattg
gttgcttgctggacaaaagctcaggacggcagcagccccttgtctctccaggatctgatt
gagaaagttgtcatcctccgcaaagctgtacagctcacccaagccttggacaccaatact
gtcggggctcttctggctgagaagatgagtcagtatgccagcttgttggcagcccagggc
agcattgccgcagccttggcttttctgcctgacaacaccaaccagccaaatattgtgcag
ctgcgtgacagactctgtaaagctcaaggcaagcctgtgtcgggacaggaatcttctcag
agcccatatgagaggcagccactgtccaagggcaggcctggaccagttgctggccactcg
cagatgcccagagttcaaactcagcaatattatccccatggagaaaatcccccacctcca
ggtttcataatgcagggcaatgtcattccaaaccctgctgccccgctgcccacggctcca
ggccacatgcccagccagctgccaccttacccacagccgcagccttaccagccagcccag
cagtattccttcggaacagggggggcagcagcttatcgacctcaacagcctgttgctcct
cctgcttctaacgcttaccctaacaccccgtacatatctcctgtggcttcctattctggg
cagcctcagatgtacacagcccagcaagcctcctcacctacctccagctctgctgcttct
ttcccccctccctcctctggagcatccttccagcatggcggaccaggagctccaccatca
tcttcagcttatgcactgcctcctggaacaacaggtacaccgcctgctgccagtgagctg
cctgcgtcccaaagaacagaaaatcaatctttccaagaccaggcatctatattggaaggt
cctcagaatggttggaatgatcctccagctctgaacagagtgccgaagaagaagaagatg
cctgaaaacttcatgcctcctgttcccattacgtcaccaatcatgaacccttcgggtgat
ccccagtcacaggggctgcagcagcagccttcaactccagggccgctgtcaagccacgcc
tccttcccacagcagcacctagcgggcggccagcccttccatggtgtacagcagcctctt
gctcagacaggcatgccgccgtccttctcaaagcccaacactgaaggggctccaggagct
cccattggaaacaccatccagcacgtgcaggctctgccaacagaaaagattactaagaaa
cctattccggaggagcacctcatcctaaagacgacatttgaggaccttatccagcgctgc
ctctcctccgctacagacccccaaaccaagaggaagctggacgacgccagcaagcgcctg
gagttcctctacgacaagcttagggaacagacactctccccgaccatcatcaacggtctc
cacagcatcgccaggagcattgagacgaggaactactcggaagggttgagcgtccacact
cacatcgtcagcaccagcaacttcagtgagacctcggccttcatgcccgtcctcaaggtt
gtcctcagtcaggccagcaagctgggtgtctga

DBGET integrated database retrieval system