KEGG   Mus musculus (house mouse): 110380
Entry
110380            CDS       T01002                                 
Symbol
Shroom2, 4832440C16, Apxl, C630003H05Rik, Shrm2
Name
(RefSeq) shroom family member 2
  KO
K18625  protein Shroom
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    110380 (Shroom2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     110380 (Shroom2)
SSDB
Motif
Pfam: ASD2 ASD1 PDZ PDZ_6 Peptidase_M50
Other DBs
NCBI-GeneID: 110380
NCBI-ProteinID: NP_001277613
MGI: 107194
Ensembl: ENSMUSG00000045180
UniProt: A2ALU4
Position
X:complement(151392505..151553784)
AA seq 1481 aa
MEGAEPRARPERLAEAEAPATDGVRLVEVQLSGGAPWGFTLKGGREHGEPLVITKIEEGS
KAAAVDKLLAGDEIVAINDVSLSGFRQEAICLVKGSHKTLKLVVKRKSDPSWRPHSWHAT
KYFDVHPEPAASLFLNTSGSPSWKSQHQASSSSHDLSGSWEHTSLQRTSDHFSSMGSIDS
LDHSSQLYPSGHLSSAKSNSSIDHLGGHSKRDSAYGSFSTCSSTPDHTLPKADASSTENI
LYKVGLWEASRPGSSRQSQSTGDPQGLQDRPSCFIPRVPGNSSKSPRPEDNVEPKIATHG
RSNFGPVWYVPDKKKAPSPPPLGLPLRSDSFSVAARGHEKARGPPFSDLASMQHFITLPH
VQPRGDHRMETTDRQWKLTHLSSGKEIGNVGYQSEGHLDCRWLCSDDRAGRPSGPPGRLQ
FSDVHFLKSYHGSQHQQQCSDESPRAPSSPRELLHITPGGGLQEPPEPSQDDNPTQVRWP
GSAHQKLDDRGRSHYFPGSLRQPVQGSAQVVIPRGDYWHSDTTPVDLEYPLLRPVGQRTY
LQQHEETPASHEKEGYHQLNAGIEGCCSGIQEPPRASRTVRTGLQCPSNDFKLVDGESGR
ISRQRTPMLHSLTQDGTWRPGNSKDCGNDKPPLFDAQVGKPTRRSDRFATTLRNEIQMRR
AKLQKSKSTVTLAGDSEAEDCAGDWRADVGAVPEGSFPSTYKEHLKEAQTRVLKATSFQR
RDLDPTPADQYSGPSEHRTFDHSASSSLSSFPGEPDSAPRFCETGLAKAPSSGVGVPHVL
RIGGRKRFTAEQKLKSYSEPEKINEVGLSGDHRPHPTVRTPEDTVGTFADRWKFFEETSK
SLLQKAGHRQVHCGLPREKAERPQTGHHECESTEPWFQKRSLATSCGEILSDRKVEKASE
KLNPPRRLGTFAEYQASWKEQKKPLEARSSGRYHSADDILDAGLDQQQRPQYIHERSRSS
PSTDHYSQEVPVEPNRQAEDSGDHKEAILCTLQAEEGCSAPSAQPQDSQHVNEDTTFPQP
ETQLSSKCQHLQTSAMETSRSPSPQFAPQKLTDKPPLLIHEDNSARIERVMDNNTTVKMV
PIKIVHSESQPEKESRQSLACPAELPPLPSGLERDQIKTLSTSEQCYSRFCVYTRQEVEA
PHRARPPEPRPPSTPAPPVRDSCSSPPSLNYGKAKEKTMDDLKSEELAREIVGKDKSLAD
ILDPSVKIKTTMDLMEGIFPKDEYLLEEAQQRRKLLPKVPLPRVTEDKKQDPGMPGVVSL
ATNSTYYSTSAPKAELLIKMKDLQEPEEYSAGDLDHDLSVKKQELIDSISRKLQVLREAR
ESLLEDIQANNALGDEVEAIVKDVCKPNEFDKFRMFIGDLDKVVNLLLSLSGRLARVENA
LNNLDDNPSPGDRQSLLEKQRVLTQQHEDAKELKENLDRRERIVFDILATYLSEENLADY
EHFVKMKSALIIEQRELEDKIHLGEEQLKCLFDSLQPERSK
NT seq 4446 nt   +upstreamnt  +downstreamnt
atggagggcgccgagccccgtgcacggcccgagcgcctggccgaagctgaggcgccggcg
accgacggcgtccgcctggtggaggtgcagctgagcggcggcgccccttggggcttcacc
ttgaagggcggccgcgagcatggcgagcctctggtcatcaccaagattgaagaaggaagc
aaagctgcagcagtggacaagctacttgctggagatgagatagtggccattaatgatgtg
agtctctcagggttcagacaagaagcaatttgcctggtgaaaggctcccacaagaccctg
aagcttgtggtcaaaaggaaaagtgatccaagttggaggccccactcctggcacgctacc
aagtactttgatgtccaccctgagccagcagcctcactgtttctgaacaccagcggttcc
ccttcctggaagagccagcaccaggctagttcttcctctcatgatttatctggctcatgg
gagcatacaagcctacagcgcacttctgaccacttcagctccatgggcagcatagacagc
ctcgaccacagctcccaactctacccatctggacacctctcatctgccaagtccaatagc
agcattgaccacctgggaggccacagcaagcgagactcagcttacggctccttttccaca
tgctccagcacccctgaccacaccttgcccaaggctgatgcctcttccactgagaacatt
ctctataaagttggcctttgggaggcctccagaccaggcagcagccgacaaagccagtct
acaggtgatcctcagggactgcaggacaggccatcatgtttcatacctagggttcctggt
aacagtagtaaaagtccaaggccggaggataatgttgaacccaaaatagccactcatggg
agatccaattttgggcctgtgtggtatgttcctgacaagaaaaaagccccttctccccca
cctcttggacttcctttgcgcagtgatagcttttctgtggcagccaggggccatgaaaaa
gcccggggccctccattctcagacttggccagtatgcagcactttatcaccctgccccat
gtgcaaccccggggggaccatagaatggaaactacagatcgtcagtggaagctcacacac
ctaagcagtggaaaagaaataggaaatgtgggttaccagtcagaaggccacctggattgc
cgttggctatgctctgatgatagagcaggtaggccctcagggcctccgggcaggctccag
ttctccgatgtgcactttctgaagtcttaccacgggagccagcaccaacagcagtgcagt
gacgagagcccaagggccccctcatcaccaagggaactgcttcatataactcctggtggc
ggtctgcaagagcctcctgaaccatctcaggatgacaaccctactcaggtgaggtggcct
ggttctgctcaccagaagctagatgacagagggcggagccactattttcctgggtccctc
aggcagcctgtacaggggagtgcccaggttgtgataccccgaggtgactattggcattca
gatacaactcctgtggaccttgaatatcctctcttacgcccagtaggacagaggacctac
ctacagcagcatgaggagactccggcctctcatgaaaaagaggggtatcaccagctaaat
gcagggattgaaggctgctgctctggaatccaagagcctcctagagccagccgcactgtg
agaactggtctgcagtgtcctagcaatgacttcaaattagtggatggagagagtgggaga
atttctcgtcagaggacacccatgctgcattctctgacccaagatggtacatggagaccc
gggaacagcaaggattgtggaaatgataagccaccactgtttgatgcccaggtgggtaaa
cccacacggaggagtgaccgttttgccacaacactgaggaatgagatccaaatgcgtaga
gcaaagctgcagaagagcaaaagtacagtgacactagctggagacagtgaagctgaagat
tgtgctggagactggagagctgatgtgggggctgtcccagaaggttccttccccagcacc
tataaagagcacctgaaggaggcccagacacgtgttctgaaggccacctctttccaacgc
cgagatttagatcccaccccagcagatcagtattcaggaccatcagaacacaggactttt
gaccacagtgcctcatcttctttatcttctttccctggggagccagactctgccccacgc
ttctgtgagacaggtctggccaaggcaccctcttctggagttggtgtaccccacgttctt
cgaattggaggccggaaacggttcacagcagagcagaaactaaagtcctattctgagcca
gagaaaataaatgaagtggggctctcaggggaccaccgtcctcatcctactgtcaggaca
cctgaggatacagtgggtacatttgctgacaggtggaagttttttgaggaaacaagcaaa
tctcttctccagaaggcaggccataggcaagttcactgtgggctccctagagagaaggct
gagaggccacagacagggcaccatgaatgtgagagtacagagccctggttccagaagagg
tcactggccacctcctgcggagagatcctcagtgatagaaaagtagaaaaggcctcagag
aaattgaacccacccagaaggcttggaaccttcgcagaatatcaagcatcttggaaggaa
cagaagaaacctctggaagccaggagttctggacgataccattcagcagatgatattctg
gatgctggtctagatcagcagcagaggccacagtacattcatgagcggtctcgttcatca
ccgtccacagatcactactcacaggaagtgcctgttgaaccaaacaggcaggcagaggac
tctggtgaccacaaagaagcaattctctgtacactacaagctgaggagggatgctctgct
ccaagtgcccagccgcaagacagccagcatgtgaatgaagacacaactttccctcaacca
gaaacccagctctcttccaagtgtcaacacctacagacgtcagccatggaaacttctcgc
tccccttcgcctcagtttgccccacagaagctgacagataaacctcccctgcttatccat
gaagacaactcagcaagaatcgagcgggtgatggacaacaacaccactgtgaagatggtg
cccataaaaattgtgcactcagaaagccagcccgagaaggagagtcgtcagagtctcgcg
tgcccagctgagctgcccccactgcccagtgggctggagagggaccagatcaagacactg
agtacatcagagcaatgctactcccgcttctgtgtgtacacacgacaggaggtggaagct
cctcatagagcccgccctccagagccccggccacccagcacgcctgcacctcctgtcaga
gatagctgttcctcccctccctcactcaactatgggaaggccaaggagaaaaccatggat
gacttgaagtctgaagaattagccagggagattgtgggaaaggacaagtctttggctgac
atcctggaccccagtgtgaagatcaaaactaccatggatctgatggagggaatttttccc
aaagatgagtacctcctagaggaagctcagcagcggagaaagctgctccccaaagtcccc
ttacccagagtcacagaggacaagaaacaggacccaggtatgccaggggttgtgtccttg
gccaccaattctacctattacagcacatcagcccccaaagcagagcttcttatcaagatg
aaggacctgcaggagcctgaagagtattcagcaggtgacttggatcatgacctttctgtt
aagaagcaagagctcattgacagtatcagccgcaagctgcaggtgctccgggaagcacgt
gagagcctgctggaagacatccaagccaacaatgctcttggggatgaggtggaagccatt
gtgaaagatgtctgcaagcccaatgagtttgacaagttccggatgttcattggagacctg
gacaaagtggtgaacctcctgctgtcactgtcaggacgcctggcccgtgtggaaaatgcc
cttaataatttagatgacaatccttctcctggagatcggcagtcactgttggagaaacag
agagtcctaactcagcagcacgaggatgccaaggagcttaaagagaacctggaccgccgt
gagcgcattgtgttcgacatcctggctacctacctcagcgaggagaacctggctgactat
gagcacttcgtgaagatgaagtcagctctcatcattgagcagcgagagctggaagataaa
atccacctgggtgaagagcagctcaagtgtttgtttgacagcctacagcctgagagaagc
aaatga

DBGET integrated database retrieval system