KEGG   Mus musculus (house mouse): 110460
Entry
110460            CDS       T01002                                 
Symbol
Acat2, AW742799, Tcp-1x, Tcp1-rs1
Name
(RefSeq) acetyl-Coenzyme A acetyltransferase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00620  Pyruvate metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu00650  Butanoate metabolism
mmu00900  Terpenoid backbone biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01212  Fatty acid metabolism
mmu04975  Fat digestion and absorption
Module
mmu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110460 (Acat2)
   00630 Glyoxylate and dicarboxylate metabolism
    110460 (Acat2)
   00650 Butanoate metabolism
    110460 (Acat2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110460 (Acat2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110460 (Acat2)
   00310 Lysine degradation
    110460 (Acat2)
   00380 Tryptophan metabolism
    110460 (Acat2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    110460 (Acat2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    110460 (Acat2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    110460 (Acat2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     110460 (Acat2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110460 (Acat2)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Other DBs
NCBI-GeneID: 110460
NCBI-ProteinID: NP_033364
MGI: 87871
Ensembl: ENSMUSG00000023832
UniProt: Q8CAY6
Position
17:complement(13161929..13179612)
AA seq 397 aa
MNAGSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHV
LTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGME
NMSKAPHLTHLRTGVRMGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDK
VAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFPRHGSNLEAMGKLKPYFLT
DGTGTVTPANASGMNDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPA
IKQAVAKAGWSLEDVDLFEINEAFAAVSAAIAKELGLNPEKVNIDGGAIALGHPLGASGC
RILVTLLHTLERVGGTRGVAALCIGGGMGVAMCVQRG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgaatgcgggctcagaccccgtggtcatcgtctcagcggcgcgcaccgctataggctcc
ttcaatggtgccctgtccaccgtgcctgtccacgaaatggggacaactgtcatcaaagaa
gtcctgcagagggccaaggtggctccagaagaggtgtccgaggtcatatttggacatgtc
ttgacggcaggttgtgggcagaatcctactcgacaagccagtgtgggtgcagggatcccc
tattcggttccagcatggagctgccagatgatctgtggctcgggcctaaaagccgtgtgt
cttgcagcccagtccatagccatgggcgactccaccattgtggtagctggaggcatggag
aatatgagcaaggctcctcacttgactcacctgagaacaggagtcaggatgggtgaggtg
ccactggctgacagcatactctgtgatggtctgacagatgcctttcacaactaccacatg
ggcatcacagctgaaaacgtagccaaaaaatggcaagtgagcagagaggcccaggacaag
gttgcagttctgtcacagaacagggcagagcatgctcagaaagctggccactttgacaag
gagattgtgccagtgctggtgtcttccagaaaaggtcttactgaagtgaaaatcgatgaa
tttccccgtcatgggagtaaccttgaagccatgggcaagctgaaaccttactttcttact
gatgggacaggaactgtcaccccagcgaacgcatcaggaatgaacgatggcgctgctgct
gtggtccttatgaagaagacagaagctgagaggcggatgctgaaacctttagcaagaata
gtctcctggtcccaagccggtgtggagccttctgttatgggagtaggaccaattccagcc
ataaagcaagctgttgcaaaggcaggctggtccctggaggatgttgacctgtttgaaatc
aatgaagcctttgcagcggtgtctgcggcaatagctaaagaacttggattaaaccccgag
aaggtcaacatcgatggaggagccattgccttgggccatcctctgggagcatctggctgc
aggattctagtgaccttgctgcacaccctggagagagtgggcgggacccgtggtgttgca
gccctgtgcattgggggtgggatgggagtcgcaatgtgtgttcagagagggtga

DBGET integrated database retrieval system