KEGG   Mus musculus (mouse): 110524Help
Entry
110524            CDS       T01002                                 

Gene name
Dgkq, 110kDa, DAGK, DAGK7, Dagk4, Dgkd
Definition
(RefSeq) diacylglycerol kinase, theta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    110524 (Dgkq)
   00564 Glycerophospholipid metabolism
    110524 (Dgkq)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    110524 (Dgkq)
   04072 Phospholipase D signaling pathway
    110524 (Dgkq)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    110524 (Dgkq)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     110524 (Dgkq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc C1_1 DAGK_cat RA C1_2
Motif
Other DBs
NCBI-GeneID: 110524
NCBI-ProteinID: NP_950176
MGI: 102918
Ensembl: ENSMUSG00000004815
Vega: OTTMUSG00000026824
UniProt: Q6P5E8
Position
5 F; 5 53.24 cM
AA seq 934 aa AA seqDB search
MAAAAEPGARTWPGSGSPRLGSPAGSPVLGISGRTRPGSGPERTSRAIGSAAPGHSFRKV
TLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKQVKTPCTSIAPSLVRVPVAHCFGS
LGLYKRKFCVVCRKSLEVPAFRCEVCELHVHPDCVPFACSDCRQCHQDGQQDYDTYHHHW
REGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSVCSTALAPECTFGRLRSMVLPP
SCVRLLSRNFSKMHCFRIPETMVLELGDGDDGVDGSAAIGTGREVLTATESTKQTLKIFD
GNDSMRKNQFRLVTVSRLARNEEVMEAALRAYYISEDPKDFQLQALPLSGNAQALGKAGT
TEEEASKGSCPRDSVPEAWVIRSLPRTQEILKIYPGWLKVGVAYVSIRVNSQSTARSVVQ
EVLPLFGQQVEDKERFQLIEVLMSSRQVQRTVLADEEPLLDRLWDIRQTSVRQVSQTRFY
VAETRATAPRVSLFVGGLPPGLSPQDYSNLLHEAMATKAAVVSVSHVYSLQGAVILDVTC
FAEAERLYMLARDTAVHGRPLTALVLPDVLHTKLPPDCCPLLVFVNPKSGGLKGRELLCS
FRKLLNPHQVFELTNGGPLPGFHLFSQVPSFRVLVCGGDGTVGWVLAALEETRRHLACPE
PSVAILPLGTGNDLGRVLRWGAGYSGEDPFSVLVSVDEADAVLMDRWTILLDAHEIDSTE
NNVVETEPPKIVQMNNYCGIGIDAELSLDFHQAREEEPGKFTSRFHNKGVYVRVGLQKIS
HSRSLHKEIRLQVEQQEVELPSIEGLIFINIPSWGSGADLWGSDNDSRFEKPRIDDGLLE
VVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISATAP
KVHMLRKAKQKPRKAGANRDTRVDTLPAPEGNPL
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagccgagcccggtgcccggacctggccgggcagtggttccccacgtctt
ggcagcccggccggcagtccagtgctgggcatctcgggccgcacacgcccggggtcaggg
ccggagcggactagcagagctattggctccgcagcacctggccacagctttcgcaaggtg
acactcaccaagcctaccttctgccacctctgctcggacttcatctggggactggctggc
ttcctgtgcgatgtctgcaacttcatgtcccatgagaagtgcctgaagcaggtgaagacc
ccgtgcacaagcattgcaccaagcctcgtccgggtgcctgtagcccactgctttggttcc
cttggtctctacaagcgcaagttctgtgtggtctgccgcaagagcctggaggtacccgca
ttccgctgtgaagtgtgtgagctgcacgttcaccccgactgtgtgcccttcgcctgcagc
gactgtcgtcagtgccaccaggatggacagcaggattatgacacgtatcaccaccactgg
agggaggggaacctgccttctggtgcacgatgtgaggtctgtaggaagacttgtggttcc
tcagatgtgctggctggtgtacgctgcgagtggtgtggtgtacaggctcactcagtgtgc
tccacagcacttgcgcctgagtgtacatttggacgtctacgctccatggtactgcctcct
tcgtgtgtgcgcctgttgtcccgaaacttcagcaagatgcactgtttccgaatccctgag
accatggtcctggagcttggtgatggggatgatggcgtagacgggagtgctgctataggc
acaggcagagaggtactgacagctacagagtccaccaaacagaccctgaagatctttgat
ggcaacgactccatgaggaaaaatcagtttcgtctggttacagtttcccgcctggctcgg
aatgaggaagtgatggaggcagcacttcgggcctactatattagcgaggaccctaaggac
ttccagctgcaggcactgcccctgtctggcaatgcccaggctctggggaaggctgggacc
actgaggaggaggctagtaaaggctcttgtccccgggattccgtgcctgaggcctgggtc
atcaggtctttgcctcgtacccaagagatcctgaagatctaccctggctggctcaaggta
ggtgtggcctacgtgtccatccgtgtgaactcccagagtacagcacggtctgtggttcaa
gaggttctcccactgtttggacaacaggttgaggataaggagagattccagctgattgag
gtgctcatgagcagcagacaagtccaacggaccgtgctggcagatgaagaacctctgcta
gaccgactctgggacatccgacagacttctgtgcgccaggtgagccagacgcggttctac
gtggccgagaccagggccacggccccacgtgtctccctgttcgtgggtggcctgccacct
ggcttgtccccccaggattacagcaacctgctgcatgaggccatggccaccaaagctgct
gtggtgtctgtgagtcacgtctactccttacaaggtgcagtaattctggacgtcacctgc
ttcgcggaggctgagcggctatacatgctggccagggacacagcagtgcatggccggcca
ctgactgcattagtgcttccagatgtgctgcacacgaagctgcctcctgactgctgccct
ctcctcgtgtttgtgaaccccaagagtgggggtctcaagggacgagaactgctctgcagt
ttccggaagctgctgaatccgcaccaggtctttgagctaaccaacgggggccctcttcct
gggttccaccttttctcccaggtgcccagttttcgggtactggtgtgtggtggagatggc
accgttggctgggtgctcgctgccctggaggagacaaggcgccatctggcctgtccagag
ccatctgtggccatcttgcccctgggtacagggaatgaccttggccgggtccttcgttgg
ggggcaggctatagtggtgaggacccattttctgtgctggtgtcggtggatgaggctgat
gctgtgctcatggatcgatggacaatcctgctggatgctcatgaaattgatagtacagag
aacaatgtggtagaaacagagccccccaagattgttcagatgaataactactgtggcatt
ggtattgatgcggagctcagcctggacttccaccaggcacgtgaagaggagcctggcaaa
ttcacaagcaggttccacaacaagggcgtgtatgtgcgggtcgggctgcagaagatcagc
cactctcgaagcctacacaaggagatccggctgcaggtggagcagcaggaggtggagcta
cccagcattgagggtctcatcttcattaacatccccagctggggctcaggggccgacttg
tggggctctgacaacgactcaaggtttgagaagccacgcatagacgacgggctgttggag
gtggtgggtgtgacaggtgtcgtgcacatgggccaggtacaaggtgggctacgctctgga
atccgcattgcccagggctcctacttccgtgtcacactcctcaaggctactccagtgcag
gtggatggtgagccctgggttcaggccccaggtcacatgatcatctctgctactgcacct
aaggttcacatgctgagaaaggctaagcagaagcccaggaaggctggcgccaacagggat
acccgagtggacaccttgcctgctcctgagggcaatcctttatag

DBGET integrated database retrieval system