KEGG   Mus musculus (mouse): 110616
Entry
110616            CDS       T01002                                 

Gene name
Atxn3, 2210008M02Rik, AI463012, AI647473, ATX3, Atx, MJD1, Mjd, Sc, Sca3, atax, ataxin-3
Definition
(RefSeq) ataxin 3
  KO
K11863  Ataxin-3 [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110616 (Atxn3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110616 (Atxn3)
   05022 Pathways of neurodegeneration - multiple diseases
    110616 (Atxn3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    110616 (Atxn3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    110616 (Atxn3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     110616 (Atxn3)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C86
   110616 (Atxn3)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    110616 (Atxn3)
SSDB
Motif
Pfam: Josephin SUIM_assoc UIM Frankia_peptide
Other DBs
NCBI-GeneID: 110616
NCBI-ProteinID: NP_083981
MGI: 1099442
Ensembl: ENSMUSG00000021189
Vega: OTTMUSG00000030696
UniProt: Q9CVD2 Q546X9 Q810M8
Position
12; 12 E
AA seq 355 aa
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRT
FLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHW
FTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQM
IKVQQMHRPKLIGEELAHLKEQSALKADLERVLEAADGSGIFDEDEDDLQRALAISRQEI
DMEDEEADLRRAIQLSMQGSSRSMCENSPQTSSPDLSSEELRRRREAYFEKQQQQQQEVD
RPGPLSYPRERPTTSSGGRRSDQGGDAVSEEDMLRAAVTMSLETAKDNLKAERKK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagtccatcttccacgagaaacaagaaggctcactttgtgctcagcattgcctgaat
aacctattgcaaggagagtattttagccctgtggagctatcctcaattgcacaccagctg
gatgaagaggagaggctgagaatggcagaagggggagtcactagtgaagactaccgcaca
tttttacagcagccttctggaaatatggatgacagcggctttttctctattcaagttata
agcaatgctttgaaagtttggggtttagaactaatcctgttcaacagtccagagtaccag
aggctcagaattgatcctataaacgaaagatcctttatatgcaattataaagaacactgg
tttacagttagaaaattaggcaagcagtggtttaacttgaattctctgttgacgggtcca
gaattaatatcagatacatacctcgcactattcttggctcaattacagcaagaaggttat
tctatatttgttgttaagggtgatctgccagattgtgaagctgaccaacttttgcagatg
atcaaggtccaacagatgcatcgaccaaaacttattggagaggaacttgcacatctgaaa
gagcagagtgccctcaaagcagacctggagcgcgtcttagaagcagctgatgggtcgggc
atatttgatgaagatgaggatgatttacagagggctctagccataagtcgccaggaaatc
gacatggaggatgaagaagctgatctccgcagggccattcagctcagtatgcaaggtagt
tccagaagtatgtgtgaaaatagtccacagacatcaagtccagatctctcttcagaagag
ctgcggaggagacgagaagcctactttgaaaagcaacagcagcagcagcaggaggtagac
cgacctggacccctttcatatccacgtgaaagaccgaccacaagttcaggaggacgtagg
agcgaccaaggaggcgacgctgtgagtgaagaggacatgcttcgggcagctgtgaccatg
tctttagaaactgctaaagacaacttgaaagcagaaagaaaaaaatag

DBGET integrated database retrieval system