KEGG   Mus musculus (mouse): 110651
Entry
110651            CDS       T01002                                 

Gene name
Rps6ka3, MAPKAPK-1b, MPK-9, Rs, Rsk2, S6K-alpha3, p90RSK3, pp90RSK2
Definition
(RefSeq) ribosomal protein S6 kinase polypeptide 3
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04114  Oocyte meiosis
mmu04150  mTOR signaling pathway
mmu04714  Thermogenesis
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04931  Insulin resistance
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110651 (Rps6ka3)
   04150 mTOR signaling pathway
    110651 (Rps6ka3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110651 (Rps6ka3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110651 (Rps6ka3)
  09156 Nervous system
   04720 Long-term potentiation
    110651 (Rps6ka3)
   04722 Neurotrophin signaling pathway
    110651 (Rps6ka3)
  09159 Environmental adaptation
   04714 Thermogenesis
    110651 (Rps6ka3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110651 (Rps6ka3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110651 (Rps6ka3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    110651 (Rps6ka3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    110651 (Rps6ka3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110651 (Rps6ka3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110651 (Rps6ka3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110651 (Rps6ka3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo ABC1 Pkinase_fungal Pkinase_C APH Haspin_kinase TCAD9 YrbL-PhoP_reg tRNA-synt_1f
Other DBs
NCBI-GeneID: 110651
NCBI-ProteinID: NP_683747
MGI: 104557
Ensembl: ENSMUSG00000031309
Vega: OTTMUSG00000016505
UniProt: P18654
Structure
PDB: 

Position
X F4; X 73.27 cM
AA seq 740 aa
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEGSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgccgctggcgcagctggcggacccgtggcagaagatggctgtggagagcccttccgac
agcgcggagaatggacagcaaattatggatgaacctatgggagaggaggagattaaccca
caaactgaagaaggcagtatcaaagaaattgcaatcacacatcatgtgaaggaaggacat
gaaaaggcagatccttcccagtttgaacttttaaaagtattagggcagggatcatttgga
aaggttttcttagttaaaaaaatctcaggctctgatgctagacagctttatgccatgaaa
gtattaaagaaggccacgctgaaagttcgagaccgtgttcggacaaaaatggaacgtgat
atcttggtagaagtcaatcaccctttcattgtcaaattgcattacgcttttcaaacggaa
gggaagttgtatcttattttggattttctcaggggcggagacttgtttacacgcttatcc
aaagaggtgatgttcacagaggaagatgtcaaattctacttggctgaacttgcacttgct
ttagaccatcttcatagcctgggaataatctatagagacttaaaaccagaaaacatactt
cttgatgaagaaggtcacatcaagttaactgattttggcttaagtaaggaatctattgat
catgagaagaaggcttattctttttgtggcactgtggaatacatggctccagaagtagtt
aaccgcagaggtcacactcagagtgcggactggtggtcctttggtgtgttgatgtttgaa
atgctcactggtacactacctttccaaggaaaagatcgtaaagaaacaatgactatgatt
cttaaagccaaactcgggatgccacagtttctgagtcctgaagcccagagtcttttacga
atgcttttcaaacggaatcctgcaaacagattaggtgctggaccagatggagttgaagaa
attaaaagacattcatttttctcaacaatagactggaataaactatatagaagagagatt
cacccaccttttaagcctgcaactggcagacctgaagatacattttattttgatcctgag
tttactgcaaaaactcccaaagattcaccgggcattccacctagtgctaacgcacatcag
ctttttcgggggtttagttttgttgctattacctcagatgatgaaagccaagctatgcag
acagttggtgtgcattcaattgttcagcaattacacagaaacagtattcagtttactgat
ggatatgaagtaaaagaggatattggcgttggctcatactccgtttgtaagagatgtata
cataaagctacaaacatggagtttgccgtgaagattattgataaaagcaagagagaccca
acagaagagattgaaattcttcttcgctatggacagcatccaaacatcattaccctaaag
gatgtgtatgatgatggaaaatatgtgtatgtagtaacagaacttatgaaaggaggtgaa
ttgctggataagattcttagacagaagtttttctcagagcgagaggccagcgctgtcctg
tttactataaccaaaactgttgagtatcttcatgcacaaggggtggttcacagagacttg
aaacctagcaacattctttatgtggatgagtctggtaatccagaatctattcgaatttgt
gattttggctttgcaaaacaactgagagcagaaaatggtcttctcatgactccttgttat
actgcaaattttgttgcaccagaggttttaaaacggcaaggttatgatgctgcctgtgat
atatggagtcttggcgtcctcctttatacaatgcttactggttacactccatttgcaaat
ggccctgatgatactccagaggaaatactggcacgaataggtagtggaaaattctcactc
agtggtggttactggaattctgtttcagacacagcaaaggacctggtgtcaaagatgctt
catgtagatcctcatcagagactgacggctgctctggtgctcagacatccttggattgtc
cactgggaccaactaccacaataccaactaaacagacaggatgcgccgcatctcgtaaag
ggtgccatggcagctacgtactctgctttaaaccgcaatcagtccccagtcttggaacca
gtgggccgctccactcttgctcagcggagagggattaaaaaaatcacctcaacagccctg
tga

DBGET integrated database retrieval system