KEGG   Mus musculus (mouse): 110695Help
Entry
110695            CDS       T01002                                 

Gene name
Aldh7a1, Atq1, D18Wsu181e
Definition
(RefSeq) aldehyde dehydrogenase family 7, member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00260  Glycine, serine and threonine metabolism
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Module
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
mmu_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110695 (Aldh7a1)
   00053 Ascorbate and aldarate metabolism
    110695 (Aldh7a1)
   00620 Pyruvate metabolism
    110695 (Aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110695 (Aldh7a1)
   00561 Glycerolipid metabolism
    110695 (Aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110695 (Aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    110695 (Aldh7a1)
   00310 Lysine degradation
    110695 (Aldh7a1)
   00330 Arginine and proline metabolism
    110695 (Aldh7a1)
   00340 Histidine metabolism
    110695 (Aldh7a1)
   00380 Tryptophan metabolism
    110695 (Aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110695 (Aldh7a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110695 (Aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     110695 (Aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     110695 (Aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110695
NCBI-ProteinID: NP_613066
MGI: 108186
Ensembl: ENSMUSG00000053644
Vega: OTTMUSG00000035214
UniProt: Q9DBF1
Position
18 D3; 18 30.55 cM
AA seq 539 aa AA seqDB search
MWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDA
FREKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIE
MWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLED
NLLPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEVALMVQERFGKSLLELGGN
NAIIAFEDADLSLVVPSVLFAAVGTAGQRCTTVRRLFLHESIHNEVVDRLRSAYSQIRVG
NPWDPNILYGPLHTKQAVSMFVRAVEEAKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHD
APIVHQETFAPILYVFKFQDEEEVFEWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtgtgccccgcaggctctgtgtgcagtctgtgaagaccagcaagctttccgga
ccttggagcaggcccgccgcccacatgtctactctgctgatccatcatccccagtatgcc
tggctgcaagacctggggctccgcgaggataacgagggcgtgtataatggaagctggggc
ggccggggagaggtaattacgacctattgtcctgctaacaatgagccaatagcaagagtc
cgacaggccagcctgaaggactatgaagaaaccatcgggaaagccaagaaagcctggaac
atctgggcagatattcctgccccaaaacgcggagaaatagtcagaaagattggcgatgcc
ttccgggagaagatccaactactgggaagactggtgtctttggagatggggaaaatcctg
gtggaaggaataggcgaggttcaggagtacgtggacgtctgcgattatgctgctggcttg
tcgaggatgatcgggggacccaccttgccttctgaaagacccggccatgctctcatcgaa
atgtggaatcccttaggcttggtgggaatcatcactgccttcaatttccccgtggctgtg
tttggctggaacaatgccatagctctgatcacagggaatgtctgcctttggaaaggagca
ccgactacgtccctcgttagtgtggctgtcacaaagatcatagcccaggttttggaggac
aacctgctgcccggtgccatttgttccctggtttgtggtggagcagatatcggcacaacg
atggccagagatgagcgtgtgaacctgctgtccttcactgggagcactcaggtggggaag
gaggtggccctcatggtgcaggagaggtttgggaaaagcttgttggagcttggaggaaac
aatgccattattgctttcgaggacgcggacctcagcttggttgttccgtcagttctgttt
gccgccgtgggaacagctgggcaaaggtgtaccactgtgaggagactgtttttgcacgaa
agcatccataatgaagttgtggacagactgagaagtgcctactcacagatccgtgttggg
aacccctgggaccccaatatcctctatggaccgctccataccaaacaggcagtgagcatg
tttgtgagagccgtggaagaagccaagaaacaagggggcacagtggtctatgggggcaag
gtcatggaccaccctggcaattacgtggaacccaccattgtgaccggtcttgcccatgat
gcgcccattgttcaccaggagacttttgccccaatcctctatgtcttcaaattccaggat
gaagaagaggtctttgaatggaacaatgaagtaaaacagggactttcaagtagtatcttt
accaaagatttgggcagaatcttccgctggcttggacctaaaggttccgactgtggcatc
gtgaacgtcaatattcctaccagcggggctgagattggtggtgcgtttggcggagagaag
cacactggcggtggccgggagtctggcagcgacgcctggaagcagtacatgaggagatcc
acatgtaccatcaactacagcacgtccctccctctggctcagggaatcaagtttcagtga

DBGET integrated database retrieval system