KEGG   Mus musculus (mouse): 110750
Entry
110750            CDS       T01002                                 

Gene name
Cse1l, 2610100P18Rik, AA407533, C, Ca, Capts, Cas, Xp, Xpo2
Definition
(RefSeq) chromosome segregation 1-like (S. cerevisiae)
  KO
K18423  exportin-2 (importin alpha re-exporter)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110750 (Cse1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    110750 (Cse1l)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    110750 (Cse1l)
SSDB
Motif
Pfam: CAS_CSE1 Cse1 IBN_N Xpo1
Other DBs
NCBI-GeneID: 110750
NCBI-ProteinID: NP_076054
MGI: 1339951
Ensembl: ENSMUSG00000002718
Vega: OTTMUSG00000001165
UniProt: Q9ERK4
Position
2 H3; 2 87.22 cM
AA seq 971 aa
MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKV
CASVTFKNYIKRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR
EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAF
ALPLTNLFKATIELCSTHANDASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMN
NFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL
LVTTGREVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEE
AFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP
SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSNNVNEFPVL
KADGIKYIMIFRNQVPKEHLLVSIPLLISHLEAESIVVHTYAAHALERLFTMRGSNNTTL
FTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ
KLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTEILQNDVQEFI
PYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSSTIA
TAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLFQRLQN
SKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK
ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDSIPDEEHFIDIEDTPGYQ
TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQ
GYLQAASVTLL
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggagctcagcgatgcgaatttacagacactaacagagtatttaaagaaaaccctggat
cctgatcctgccattagacggccagctgagaagtttctcgaatccgtagaaggaaatcag
aattacccactgttgcttttaacattattggaaaagtcacaggataatgtcattaaagta
tgtgcttcagtaaccttcaagaactatattaaaaggaattggagaattgttgaagatgaa
ccaaacaaaatttgcgaagctgatcgagtagctattaaagccaacatagtgcatctgatg
ctgagcagtccagagcagattcagaagcagctgagtgatgctattagcatcattggcaga
gaagatttccctcagaaatggcctgacttgttgacagaaatggtgaatcgctttcagagt
ggagattttcacgtcattaatggagtccttcgtacagcgcactcactatttaagagatac
cggcatgagttcaagtcaaatgagctgtggactgaaattaaacttgtcttggatgccttt
gctttgcctttgactaatctattcaaggccaccattgaactgtgcagtacccatgcaaat
gacgcctctgccctgaggattcttttttcttccttgattttgatctcaaaattgttctat
agtttgaactttcaggatctccctgaattctttgaagataatatggaaacttggatgaac
aattttcataccctcctgacactggataataagctcttgcagactgatgatgaagaggaa
gcaggcttactggagcttttaaagtctcagatctgtgataatgccgctctctatgcacag
aaatatgacgaagagtttcagcggtacctccctcgctttgtcacagctatctggaactta
ctcgttacaacagggcgagaagttaaatatgacttgttggttagcaatgcaattcagttt
ctggcttcagtttgtgaaaggccacattataagaatctgtttgaggaccagaacacgctg
acaagtatctgtgaaaaagttattgtgcctaacatggaatttagagctgctgatgaagaa
gcttttgaagataattctgaggagtacatacggagggatttggaaggctctgatattgat
actagacgcagggctgcttgtgatcttgtacgaggattatgcaaattttttgaaggtcct
gtgacaggaatcttctctggttatgttaattccatgctccaggagtatgcaaaaaacccg
tctgtcaactggaaacacaaagatgcagctatttaccttgtcacatctttggcatcaaaa
gcccagacacagaagcatggaatcacgcaagccaatgaacttgtaaacctaactgaattt
ttcgtgaatcacatacttcctgatttaaaatcaaataatgtgaatgagtttcctgtgctt
aaagctgatggtatcaaatatattatgatttttaggaatcaagtaccaaaagagcacctc
ctagtctctattcccctcttgatcagtcacctggaggctgagagtattgtcgtccacact
tatgccgcacatgctctcgaaaggctgttcactatgagagggtcaaacaataccactctt
tttacagctgcagaaatcgcaccgtttgttgagattctgctaacaaaccttttcaaagct
ctcacacttcctggctcttcagaaaatgaatatattatgaaagctatcatgagaagtttc
tccctcctgcaagaggccatcatcccctatatccccactctcatcacgcagctcacacag
aagctgctggctgttagtaagaatcccagtaaacctcatttcaatcactacatgtttgaa
gcaatatgcttgtctataagaataacctgcaaagctaaccctgctgctgttgtgaatttt
gaggaggctctgtttctagtgttcactgagatcttacaaaatgatgtacaagagtttatc
ccatatgtctttcaagtgatgtctttacttctggaaacacataaaaatgatatcccgtct
tcctatatggccttgtttccccacctccttcagccagtactgtgggaaaggacaggaaac
atccctgctctagtgaggctgctccaggcattcttagaacgaggctcaagtacaatagca
actgctgcagctgacaaaattcctggattactgggtgtcttccagaagctgattgcatcc
aaggcaaacgatcaccaaggtttctatcttctcaacagtataatcgaacacatgcctcct
gaatcagttgaccagtataggaagcagatcttcattctactattccagagactgcaaaac
tccaagaccaccaagtttatcaagagtttcttagtgtttattaacttatattgcattaag
tatggggcactagcattacaagaaatatttgatggcatacaaccaaaaatgtttggaatg
gttttggaaaaaatcattattccagagattcaaaaggtatctgggaacgtggagaaaaaa
atctgtgcagttggcataaccaaattactcacagagtgtccaccaatgatggacacggag
tacactaagctgtggactcctttgttacaatctctcattggcctgtttgaattacctgaa
gatgacagcattcctgatgaagagcatttcattgacatagaagatacaccaggataccag
actgccttctcacagctggcatttgctggtaaaaaggaacatgatcctgtaggtcagatg
gtaaacaaccccaaaatccatctggcacagtcacttcacaaactgtcaactgcttgtcct
ggaagggttccctcgatggtgagcaccagcctcaatgcagaagccttgcagtatctccaa
ggttacctgcaggcagccagtgtgaccctgttgtga

DBGET integrated database retrieval system