KEGG   Mus musculus (mouse): 110784
Entry
110784            CDS       T01002                                 

Gene name
Nr3c2, M, MR, Mlr
Definition
(RefSeq) nuclear receptor subfamily 3, group C, member 2
  KO
K08555  mineralocorticoid receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110784 (Nr3c2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    110784 (Nr3c2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    110784 (Nr3c2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110784 (Nr3c2)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   110784 (Nr3c2)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110784
NCBI-ProteinID: NP_001077375
MGI: 99459
Ensembl: ENSMUSG00000031618
Vega: OTTMUSG00000022950
UniProt: A3KN90
Position
8 C1; 8 36.34 cM
AA seq 980 aa
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTNENSYMEIVNVSCVSGATPNNST
QGSSKEKHELLPCLQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYD
QQNQQGSLSPAKIYQNMEQLVKFYKENGHRSSTLSAISRPLRSFMPDSGTSMNGGALRAI
VKSPIICHEKSPSVCSPLNMPSSVCSPAGINSMSSSTASFGSFPVHSPITQGTSLTCSPS
VENRGSRSHSPVHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSP
ANLNNSRCSVSSPSNTNNRSTLSSPTASTVGSIGSPISNAFSYTTSGASAGAGAIQDMVP
SPDTHEKGAHDVPFPKTEEVEKAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNNKINPS
SPFSVPIKQESSKHSCSGASFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DSSCEGSAFPGGIKQEPDDGSYFPETSIPSSAIIGVNSGGQSFHYRIGAQGTISLSRSPR
DQSFQHLSSFPPVNALVESWKPHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGLHEEQPQQPPPPPPQSPEEGTTYIAPTKEPSVNSALV
PQLASITRALTPSPSMILENIEPEIVYAGYDNSKPDTAESLLSTLNRLAGKQMIQVVKWA
KVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSA
MYELCQGMRQISLQFVRLQLTFEEYSIMKVLLLLSTVPKDGLKSQAAFEEMRTNYIKELR
KMVTKCPNSSGQSWQRFYQLTKLLDSMHDLVNDLLEFCFYTFRESQALKVEFPAMLVEII
SDQLPKVESGNAKPLYFHRK
NT seq 2943 nt   +upstreamnt  +downstreamnt
atggaaaccaaaggctaccacagtctccctgaaggcctagatatggaaaggcgctggagt
caagtgtctcagaccttggagcgttcttctcttggacctgcagagaggaccaatgagaac
agctacatggagattgtcaacgtcagctgcgtttccggtgctactccgaacaacagtact
caagggagcagcaaagaaaaacacgaattactcccttgtcttcagcaagacaatagtcgg
tctgggattttgccatcagatattaaaactgagctggaatccaaggaactttcagccacg
gtggctgagtccatgggtttatacatggattctgtgagagatgccgagtacacttatgat
cagcaaaaccaacaaggaagcctgagcccggcaaagatttatcaaaacatggagcagctg
gtgaagttttacaaagagaatggtcacaggtcctccacactgagtgctataagcaggcct
ttgaggtcattcatgcctgactctgggacctccatgaatggtggggccttgcgtgccatc
gttaagagcccaatcatctgtcatgagaagagcccctctgtttgcagcccgctcaacatg
ccgtcttcagtatgcagccccgcgggcatcaactccatgtcctcctccacagctagcttt
ggcagtttcccagtgcacagtcccatcactcaaggaacctcactgacatgctcccccagt
gttgaaaatagaggctcaaggtcacacagccccgtacatgcgagcaatgtgggctctcct
ctttcaagtccattaagcagcatgaaatccccaatttccagccctccaagtcactgcagt
gtaaaatctccagtatccagtccaaacaatgtccctctgcgctcctctgtgtcaagcccg
gcaaatcttaacaattcaaggtgctctgtttccagcccttccaacaccaacaatagatct
acactctccagcccgacagctagcacagtggggtccattggcagccccatcagcaatgcc
ttcagctataccacttcaggcgcttcggctggagccggtgccatccaggatatggttccc
agtccagacacccacgagaaaggtgctcacgacgttcctttccctaagacagaggaagtc
gagaaggccatttccaatggtgtgactggtcagctcaacattgtccagtacataaaacca
gaaccagatggggctttcagcagttcctgcctaggaggaaacaacaaaatcaaccccagt
tctccgttctctgtaccaataaagcaagagtcaagcaagcactcatgttcaggcgcctct
tttaaagggaaccccacagtcaacccatttccattcatggatggctcgtacttttctttt
atggatgataaagactattattccctatcaggaatcttaggaccacctgtgcccggcttt
gatagtagctgtgaaggcagtgcgttcccgggggggattaagcaagaaccagatgatggg
agctatttccctgaaaccagcatcccatcatctgccatcattggtgtgaattcaggtgga
cagtcctttcactaccggattggtgctcaaggtacaatatctttatcacggtcacctaga
gaccaatctttccaacacttgagttcctttccgcctgtcaatgcattagtggagtcatgg
aaaccacacggtgacctgtcatctaggagaagtgatgggtacccggtcctagagtacatt
ccagaaaacgtgtcaagctctactttacgaagtgtttctactggatcctcaagaccttcc
aagatctgcttggtgtgtggagatgaggcttctgggtgtcactatggggtagtgacctgc
ggcagctgcaaagtcttcttcaaaagagccgtggaaggacaacacaactatctgtgtgct
ggaagaaatgactgcattattgataagattcggagaaagaactgtcctgcctgcaggctc
cagaaatgcctccaagccggcatgaacttaggagctcgaaagtcaaagaagctggggaag
ttaaaaggccttcacgaggagcagccacagcagcccccaccgccaccaccccagagccca
gaagaggggaccacatacattgctcctaccaaggagccatcagtgaactctgcgctggtc
ccgcagctcgcctcgatcacgcgtgcgctcacgccatccccgtccatgatcctggagaac
atcgagcccgagatcgtgtatgcaggctacgacaattccaagcctgacaccgccgagagc
ctgctctccacgctcaaccgcctggcgggcaagcagatgatccaagtcgtgaagtgggcc
aaggtacttccaggatttaaaaacttgcctcttgaggaccaaattaccctcatccagtat
tcttggatgtgtctatcatcgtttgccttgagttggagatcgtacaaacatacgaacagc
caatttctctattttgcaccagacctagtttttaatgaagagaagatgcatcagtctgcc
atgtatgagctgtgccaggggatgcggcagatcagccttcagttcgtgcggcttcagctg
acctttgaggagtactccataatgaaggttttgctgctactgagcacagttccaaaagat
ggcctcaagagccaggctgcgtttgaggagatgaggacaaattacatcaaagaactgagg
aaaatggtcaccaagtgtcccaacagttctggacagagttggcagaggttctaccaactg
acgaagcttctagactccatgcatgatttggtgaatgacctgctagaattctgcttctat
accttccgagaatcccaggctctgaaggtggagtttcccgccatgctggtggagatcatc
agcgaccagctgccaaaggtggaatccgggaacgccaagcccctttactttcacaggaag
tga

DBGET integrated database retrieval system