KEGG   Mus musculus (house mouse): 110789
Entry
110789            CDS       T01002                                 
Symbol
Adgrv1, Frings, Gpr98, Mass1, Mgr1, VLGR1
Name
(RefSeq) adhesion G protein-coupled receptor V1
  KO
K18263  adhesion G-protein coupled receptor V1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    110789 (Adgrv1)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    110789 (Adgrv1)
   04147 Exosome [BR:mmu04147]
    110789 (Adgrv1)
   04030 G protein-coupled receptors [BR:mmu04030]
    110789 (Adgrv1)
Peptidases and inhibitors [BR:mmu01002]
 Mixed peptidases
  Family P2
   110789 (Adgrv1)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  USH complex and associated proteins
   110789 (Adgrv1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110789 (Adgrv1)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Others
   110789 (Adgrv1)
SSDB
Motif
Pfam: Calx-beta Laminin_G_3 EPTP 7tm_2 PAN_2 GPS DUF4929
Other DBs
NCBI-GeneID: 110789
NCBI-ProteinID: NP_473394
MGI: 1274784
Ensembl: ENSMUSG00000069170
UniProt: B8JJE0
Position
13:complement(81243187..81781504)
AA seq 6298 aa
MSVTSEPGMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNETSTTVIRLVIERIGEP
ANVTAIVSLSGEDTGDFFDTYAAAFIPARGTNRTVYIAVCDDDLPEPDETFTFHLTLQKP
SANVKLGWPRAASVTILSNDNAFGIISFSTPSSISVIEPRSRNASVPLTLIREKGTYGMV
TVTFDVSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDEVPENDELFLIQLRSVEG
GAEINASRSSVEIIVKKNDSPVNFMQSVYVVPEDDHVLTIPVLRGKDSDGNLIGSDETQV
SIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHLKFQIIDDLIPEIAESFHIM
LLKNTLQGDAVLMGPSTVQVTIKPNDKPYGVLSFNSILFERPVIIDEDTASSSRFEEIAV
VRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQFAQGQMLAPISLVVFDDDLPEE
AEAYLLTILPHTIQGGAEVSEPAQLLFYIQDSDNVYGEIAFFPGESQKIESSPSERSLSL
SLARRGGSKGDVRVIYSALYIPAGAMDPLRAKDGILNTSRRSSLLFPEQNQQVSIKLPIR
NDAFLQNGAHFLVQLEAVVLVNIFPPIPPVSPRFGEIRNISLLVTPAIANGEIGFLSNLP
IILHEPKDSSAEVVSIPLHRDGTDGQATVYWSLRPSGFNSKAVTLDDAGPFNGSVVFLSG
QNETSINITVKGDDIPELNETVTLSLDRVSVDSDVLKSGYTSRDLIILENDDPGGIFEFS
YDSRGPYVIKEGDAVELRITRSRGSLVKQFLRFHVEPRESNEFYGNMGVLEFTPGEREVV
ITLLTRLDGTPELDEHFWVILSSHGERESKLGCATLVNITILKNDYPHGIIEFVSDGLSA
SIKESKGEDIYHAVYGVIRTRGNFGAVNVSWMVSPDFTQDVFPVQGTVCFGDQEFFKNIT
VYSLVDEIPEEMEEFTIILLNATGGAQTGIRTTASLRILRNDDPVYFAEPCVLRVQEGET
ANFTVLRNGSVDGACTVQYATVDGKASGEEGDFAPVEKGETLVFEVGSREQSISVHVKDD
GIPETDEPFYIVLFNSTGDTVVYEYGVATVIIEANDDPNGVFSLEPIDKAVEEGKTNAFW
ILRHRGHFGNVSVAWQLFQNASLQPGQEFYETSGTVNFTDGEETKPVILRAFPDRIPEFN
EFYILRLVNISGPGGQLAETNFQVTVMIPFNDDPFGIFILDPECLEREVAEDVLSEDDMS
YITSFTILRQQGVFGDVRVGWEVLSREFTAGLPPMIDFILLGSFPSTVPLQPHMRRHHSG
TDVLYFSGLEGAFGTVDPKYQPFRNNTIANFTFSAWVMPNANTNGFLIAKDDSHGSIYYG
VKIQTNETHVTLSLHYKTFGSNVTYIAKSTVMKYLEEGVWLHVLIILDDGIIEFYLDGKA
MPRGIKSLKGEAITDGPGILRIGAGMDGGARFTGWMQDVRTYERKLTPEEIYELHAVPAR
TDLHPISGYLEFRQGESNKSFIVAARDDSEEEGEELFLLKLVSVDGGAQISKENTTARLR
IQKSDNANGLFGFTGACIPEMTEEGSTVSCVVERTRGALGYVHVFYTISQIESEGINYLV
DDFANASGTITFLPWQRSEVLNLYVLDEDMPELNEYFRVTLVSAVPGDGKLGSTPISGAS
IDPEKETTGITVKASDHPYGLMQFSTGLPPQPEDSMSLPASSVPHITVQEEDGEIRLLVI
RAQGLLGRVTVGFRTVSLTAFSPEDYQSTAGTLEFQSGERYKYIFVNITDNSIPELEKSF
KVELLNLDGGVSDLFRVDGSGSGEADTDFFLPPVLPHASLGVASQILVTIAASDHAHGVF
EFSPESLFVSGTEPEDGYSTVVLNVTRTRGALSAVTLQWKVDSDLDGDLAITSGNITFET
GQRIASITVEILSDEEPELDKALTVSILNVSSGSLGVLTNATLTILASDDPYGVFIFPNK
TRPLSVEEATQNVTLSIIRLKGLMGEVAVSYATIDDMEKPPYFPPNLARATQGGDYISAS
GLALFRANQTEATITISILDDAEPERSESVFIELFNSSLVDKVQNRPIPHSPRLGPKVET
VAHLVIVANDDAFGTVQLSATSVHVAENHVGPIINVTRTGGTFADVSVKFKAVPITAAAG
EDYSIASSDVVLLEGETTKAVPIYIINDIYPELEETFLVQLLNETTGGATLGPLREAVIT
IEASDDPYGLFGFQNTKFIVEEPEFNSVRVNVPIIRNSGTLGNVTVQWVAIINGQFATGD
LRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVVQVQLAAASGGGTIGLDRVANIVIPA
NDNPYGSVAFVQSVFRVQEPLERSSYANITVRRSGGHFGRLLLCYGTSDIDVVARAVEEG
EDVLSYYESPTQGVPDPLWRTWVNVSAVEETQYTCATLCLKERACSAFSVVSGAEGPRCF
WMTSWVSGTVNSSDFQTYKKNMTRVASLFSGQAVAGSDYEPVTRQWAVILEGDEFANLTV
SVLPDDAPEMDESFLISLLEVHLMNISDSFKNQPTIGHPNTSAVVIGLNGDAFGVFIIYS
VSPNTSEDGLCVEVQEQPQTSVELVIYRTGGSLGQVMVEWRVVGGTATEGLDFMGAGDIL
TFAEGETKKMAILTILDDSEPEDNESILVRLVATEGGSRILPSSDTVTVNILANDNVAGI
VSFQTASRSVIGHEGEMLQFHVVRTPPGRGNVTVNWKVVGQNLEVNFANFTGQLFFSEGT
LNKTIFVHLLDDNIPEEKEVYQVVLYDVKTQGVSPAGVALLDAQGYAAVLTVEASDEPHG
VLNFALSSRFVVLQEANVTIQLFVNREFGSLGAINVTYATVPGIVSLKNNTEGNLAEPES
DFIPVVGSLVLEEGETTAAISITVLEDDIPELKEYFLVNLTHVDLIMAPLTSSPPRLDSE
GLTAQIVIDANDGAQGMIEWQRNRFEVNETDGVVTLVAQRSRAALGQVSLFMYAQNLEAQ
AGLDYMCTPQILHFTDGERFKHVDVMILDDDMPEGDERFQLLLTNPSPGLELGKNTIALI
TVLANDDGPGVLSFNNSGHIFLREPTSLYVQESVAVLVIVREPAQGLFGTVAVQFVVTEV
NSSTESKDLSPSKGFIVLEEGVRSKTLRISAILDTEPEMDEHFVCTLFNPTGGARLGAHV
QTLITIFQNQAPLGLFSISAVENSATSIDVEESNRSVYLNVSRTNGLDLTASVQWETVSE
TAFGMRGMDVVFSIFQSFFDKTALDWCFFTVEGSVYGVMLRKSSLVVYRWQGTFVPVEDL
KVESPKTCEAFNIGVSPYLVITHGERSGEKPSINSVYMLTAGFRLVLIQTIIISGSCQVR
HFTSDSQDYFIIASRRNDSELTQVFRWNGNNFAWHQTLPVRGVLGMALFSRGGSVFLAIS
QANIRQTSLLFTWSGTQFINFQELPISGITQVEALSSGDDVYLCFAKNTFLGNQNAIDIF
VWEMGHSSLRYFQSLDFAAVKRIRSFTPASGIVHILLTAQDGSALYCWNSELNAFSFVLE
APAAHDAAFVTVKSLNSSKTLIALVGATDSHLYELTYVSSQSDFIPSLGELIFEPGDKEA
IIAVNVLDDTVPEKEESFRVQLKSPRGGAEIGINSSVRVTVLANDGAYGVVAFAQNSLHK
QLEELERDSLVTLNVERLRGTHGRITVAWEAAGSVSDVFPTSGVISFTEDQAMSMITLTV
LADDLPELSEAVVVTLTQIVTEGVEDPLKGATIDQSRSRSVLTILPSDSPYGVVRWHTES
LFNRVPEPTENITVVQLHIVRDKGLFGDISIHLIAKPNFLLHINNQATEDEDFVLQDSVI
IMKENIKETHAEVAILPDEVPELDEGLIVTIAAVNLVNPNFPAEQPRVQRPRMESAEILI
EENDDPRGIFNFHVVRDVGGVIIAHEGPPPLNVLQVPVVRMAGTFETVNVYWKATPDSAG
LEDFQPSHGMLQFADGQVIAPILVTIIDDSEFELLETFTISLVSVTGGGRLGDDVSVNVV
IAPNDSPFGIFGFEKKTVMVDGPLLSDDPDSYVTLTVVRSPGGKGAVRLHWAIEEKAKDD
LSPLNGTLYFDETESQKSVILHTLKDGMVGEDRRFIIELTAADEVEISPVKGSASVIIRG
DKSISEVGIASSSRHIIIGEPSATYNGTAIIDLVRGPGVSGEITVNWKILPPSRGEFVET
SGQLTMLDGQTAATVVIQALNDDIPEEKCHYEFQLTEISEGRMLHEASVSARITMVASDA
PYGRFSFSHEQLHVSEAAQRVNVTVVRSGGSFGRARVLYETGSRTAEAGWDFVPASGELL
FEAREKMKSLYIDILDDNLPEGPEEFVLAITRVDLQGRGYDFTIQENGLQIDQPPEIGNI
SIVRIIIMKNDNAEGIIEFDPKYTDISVEEDAGVITLPVLRLHGTYGHVSADFSSRGFSA
VPGGYVLHGSSVTFQHGQNLSFINVSIIDDNGSEFEKQFEILLIGATGGAILGRHLVSKI
TIAKSDSPFGIIRFLNQSKISLPNPSSTMALHLVLERTGGLLGEIQVSWEVVGPDAEEPL
PPHNGDFADPVSGTVSFGDGEGGVRSIILRVCPHEETEAEETFIVQLKPLREAKLDPRAK
AVTLTIQKFGDPNGVIHFAPESLSKRRFSEPPPSDGPLLVSFLVTRSKGTSGDIKVHWEL
SSEFDITRDFLSTRGFFTIADGESDASFDVHLLPDDVPEIEEEYAVQLVSVEGGAELDLG
KCTARFSVSANDDPHGVFALYSDRQSVLIGQNLDRSIQINITRLAGAFGAVAVRVQILSD
NKEDPVATENEERQLVITDGARYKVGLVPLKNQVFLSLGSNFTLQLVSVRLLSGPFYGIP
TILQEAKNAILSVPEEAANSQVGFESAAFQLMDIKAGTSQVMVSRKGTYGRLSVAWTTGY
APGSEIPEPIVIGNMTPTLGSLSFVHGEERKGVLLWTFPSPGRPEAFVLHLSGLRSSAAG
GAQLRSGFTTAEIEPMGVFQFSPSSRNITVSEDAQTIRICVQRLFGFHGDLIKVSYETTA
GSAKPPEDFEAVQKGEVFFQRFQPEIDFEITIINDQLPEIEETFYINLTSVETRGLGKGG
VNWRPRLNPDLSVAVVTIVDNDDLTGVAVSVPVTAGTVAVDSTLLAMETGSTTHPNKSKI
TTIPYTTEVFAPVTETVTVSAIPEKLATAHSVISVKPDVVPGTVLASVYGTLSIGPPIVY
VSEEMKNGTLSTADILIQRMGGFAGNVTITVKTFGGRCAQKEPSVWPFQDVYGVGNLTTW
AFEEEDFEEQLLTLTFLYGERERKIAVQILDDDEPEGQEFFYVFLTDPQGGAEIVRGKDS
TGFSAFAVIIISGSDLHNGIIGFSEESQRGLELREGADKNSQRLVVTRQPNRAFEEVQIF
WRVTLNQTVTILQEKGLNLTDELRFVAGVTTCTGGQTRCFIHLELNPKKVHQVEMPFFVE
LYDVTAGAAINNSARFAPIKLSKSGAPQSLVSFSVGSRLAVAHKKSTLISLQVARDSGTG
IMMSVNFITQELRSAETVGRVLISPAVSGKDFVRTEGTLVFEPGQKSAVLDVVLTPETGS
LNKFPKRFQIVLFDPKGGARIDKVYGTANITLISDADSQAVWGLEDLLHQPLHEDILNRV
LHNLNLRVATESTDEQLSAVMLIMEKITMEGRNQAFSIKSRTLLYELLCVLINPKRKDTR
GFSHFVEVAEHFAFSLLTDVTCGSPGEKSKTILDSCPYLSILALHWNPQQINGHKFEGKE
GDYIQIPERLLDVPEAEMLDGKNACTLVQFVEYSSQQWFIAGDNLPALKDKVLSLNVKGQ
SAQPLPNNNEVLYRIHAAEPRVVPHTSRCLLWNQAAASWLSDSQFCKVVEDASDYVECAC
SHMSVYAVYAQTDNSSSYNEAFFSAGLICISGLCLAVVSHMFCARHSMFAAKLLTHMMVA
SLGTQILFLASAYASPHLSEESCSAVAAVAHYLYLCQFSWMLIQSVNFWYVLVVSDEHTE
RRCLLFCLLSWGLPSFVVILLILILRGIYHRSMPQIYGLIHGDLCFIPNIYAALFTAALV
PLMCLVVVFVVFIHAYQLKPQWKGYDDVFRGRTNAAEIPLILYLFALISMTWLWGGLHMA
YRHFWMLVLFVIFNSLQGLYVFVVYFILHNQTCCPMKASYTVEMNGHPGPSTAFFTPGSG
IPPAGEINKSTQNLINAMEEVPSDWERSSFQQTSQASPDLKTSPQNGASFPSSGGYGPGS
LIADEESQEFDDLIFALKTGAGLSVSDNESGQGSQEGGTLTDSQIVELRRIPIADTHL
NT seq 18897 nt   +upstreamnt  +downstreamnt
atgtcggtgacctcagaaccagggatgatctcttcatttttactagtatacctgtcaacc
ttgttcatctcttttgtatttggagaagcggaaataagattcactggacagacagagttc
ttcgttaatgagacaagtaccacagttattcgtcttgtcattgagaggataggcgagccc
gcaaatgttactgccattgtgtcgctgagcggagaagacactggtgacttttttgataca
tacgccgcagcgtttatccctgccagaggaacaaacaggacagtgtacatagcagtatgt
gacgacgatcttccggagcctgatgaaaccttcacatttcacttgacattacagaaaccc
tcagcaaatgtgaaacttggatggccaagggctgcttctgtgacaatcctatcaaatgac
aatgcatttggaatcatttcctttagtacgccctcatcaatctcggtgattgagccaagg
agcagaaatgcatctgtacctcttactctcatcagagaaaaagggacctatggaatggtc
accgtgacttttgatgtatcaggtggcccaaatccccctgaggaagacttgaatccagtt
agaggaaatatcaccttcccacctggcagagcaactgtgatttacaacgtgacagttctt
gatgatgaggtaccagaaaatgatgaactatttttgattcaactgagaagtgtagaagga
ggagcagagattaatgcttctaggagctcggttgaaatcattgtgaagaaaaatgatagt
cctgtgaacttcatgcagagtgtttacgtggttcccgaggacgaccacgtactcactatt
cccgtgcttcgtgggaaggatagtgatggaaatctcattggatctgatgaaacccaagtg
tcaatcagatacaaagtaatgacttgggattcaacagcacatgcccagcaaaacgttgac
tttattgatcttcagccggatactactcttgtctttcccccttttgttcatgaatcacac
ctgaaatttcagataatcgatgaccttatacccgagatagctgagtcatttcacatcatg
ttactaaagaacaccttacagggagatgctgtgctaatgggcccttctacagtacaggtc
accattaagccaaatgacaagccctatggagttctttcattcaatagtattttgtttgaa
agaccagttataattgatgaagatacagcatccagttctagatttgaagaaattgcagtg
gttagaaatggtggcacacatgggaatgtctctgtgagctgggtgttgacacggaacagc
agtgatccctcaccagtgaccgcagacatcacccctgcttctgggactctgcagttcgca
caagggcagatgctggcgccaatttctctagtggtctttgacgatgatcttccagaagag
gctgaagcttacttacttacaatcttgcctcacaccatacaaggaggcgctgaagtgagc
gagccagcgcagcttctgttctacattcaggacagcgataatgtttatggagaaatagcc
ttttttcctggggaaagccagaagattgaaagcagccctagtgagcgatccttatccctg
agtttggcgagacgtgggggaagtaaaggagacgtgagggtgatttattctgcactttat
attcctgctggagctatggaccccttgcgagcaaaagatggcatcttaaatacatctagg
agaagcagcctccttttcccagaacagaaccaacaagtttctataaaattaccgataagg
aatgatgcattcctccagaatggggcccacttcctagtgcagttggaagctgtggtgttg
gtgaacatattccctccgattccaccagtaagtcccagattcggagaaatcagaaatatt
tcattactggttaccccagccattgcaaatggagaaattggctttcttagcaaccttcca
attattttgcatgaacccaaagattcttctgctgaggtggtatctatccccttgcatcga
gatggaactgatggccaggctaccgtgtactggagtttgcggccctctggctttaattca
aaagcagtgactttggatgacgcaggtccttttaatggctctgttgtgtttttatctgga
caaaacgaaacatcaatcaacattactgtcaaaggcgatgacataccggagttgaatgaa
actgtaaccctttctctagatagggtgagcgtggacagtgacgtcctaaaatcaggctat
actagccgagacttgattattttggaaaatgatgaccctggaggcatttttgaattttct
tatgattctagaggaccctatgttataaaagaaggagatgccgtggagctccggattact
cggtccagggggtcgcttgttaaacagttcctccgctttcacgtggaacccagagagagc
aatgaattctatggaaacatgggggtgctagaattcaccccaggagaacgggaagtagtg
atcaccctcctcaccagactggatggcacaccagagttggacgagcacttctgggtgatc
ctcagcagccatggtgagagagagagcaagctgggctgtgctacactcgtcaacataacg
attctcaaaaacgactatcctcatgggattatagaatttgtttccgatggtttgagtgca
tcgataaaagagagcaaaggggaggatatctatcatgctgtttatggtgtaatacgaact
cgaggcaactttggtgctgttaatgtatcatggatggttagtccagactttacgcaagat
gtatttcctgtgcaaggaactgtttgttttggagaccaagaattttttaaaaacatcact
gtctactcccttgtagatgaaattccagaggagatggaagaattcaccattatcctactt
aatgccactggaggagctcaaacagggatcaggacaactgcctccctgaggattctcagg
aacgatgaccccgtttactttgcagagccttgtgttttgagggtccaggagggtgagact
gccaactttacagttctcagaaatggatctgttgacggggcctgcactgtccagtatgct
accgtggatgggaaggcttcaggagaagagggagacttcgctcctgtggagaagggagaa
actcttgtgtttgaagttggaagcagagagcagagtatatctgtacatgtcaaggatgac
ggaatcccagaaacagatgagcctttttatatagtcctgttcaactcaacaggtgacaca
gtggtttatgagtacggggtagctacagtcataattgaagccaacgatgacccaaatggt
gttttctctctggagcccatagacaaagcagtggaagaaggaaagacaaatgcattttgg
attttacggcaccgaggacacttcggcaatgtttctgtggcttggcagctgttccagaat
gcttctctgcagcctggacaagagttctatgaaacatcagggactgttaacttcacagat
ggagaagaaacaaaaccagtcattctccgtgctttcccagataggattcctgaattcaat
gaattttatattctaaggcttgtaaatatttcaggtcctggaggtcaactagcagaaacc
aactttcaggtgacagtcatgattccattcaatgacgatccgtttggaattttcatctta
gatccagagtgtctagagagagaagtagctgaagatgtcctctcagaagacgacatgtct
tacatcaccagcttcaccattttgagacaacagggtgtctttggtgatgtacgggttggc
tgggaagtcctgtccagagagtttactgctggccttccaccaatgatagactttatactg
ctaggaagttttccaagcactgtgcctttgcaaccacatatgcgacgtcaccacagtgga
acagacgtcctgtacttcagtggactagagggtgcatttgggactgttgatcccaagtac
caacccttcagaaataacacaattgccaactttacgttttcagcttgggtaatgcctaat
gccaacacaaatgggtttctcatagcaaaggatgacagtcatggtagcatctactatgga
gtaaaaatccaaacaaatgaaacccacgtgaccctttcccttcattataaaacttttgga
tcaaatgttacatatattgccaagagcactgtcatgaaatatttagaggaaggtgtttgg
cttcatgttttaatcatcttagatgatggcataattgaattctatctggacggaaaggca
atgcccagaggcataaagagtctgaaaggagaagctattactgatggtcctgggatcctg
agaattggagcagggatggatggtggtgccagattcacaggttggatgcaggatgtgagg
acctatgagcgcaagctgactcccgaggagatttacgaacttcatgctgtgcctgcaagg
actgatttacacccgatttctgggtatctggagttcagacaaggagaaagtaacaagtcg
ttcattgttgctgcaagagatgacagtgaagaggaaggagaagaattattccttcttaag
ctggtctctgtggatggtggggctcagatttctaaggaaaacactactgctcggctaaga
atacagaaaagtgacaatgccaatggcctgtttggcttcactggggcttgtataccagag
atgacagaggaggggtccactgtttcctgtgtggttgagcgaacgaggggagctctgggt
tacgtgcatgttttctacaccatctcccagatcgagtcagaaggcatcaattacctcgtt
gatgattttgccaatgccagtggcactatcaccttcttgccttggcagcggtctgaggtc
ctgaatctgtacgttcttgatgaggacatgcctgagctaaatgaatattttcgggtgacg
ttggtgtctgcagttccaggagatggaaaacttggttcaactcccatcagtggtgccagc
atagatcctgagaaggaaaccacaggcatcactgtcaaagctagtgaccatccttacggc
ttgatgcagttctccacagggttgcctcctcagcctgaagattcaatgagtctgcctgct
agcagtgtgccacatatcacagtgcaggaagaggatggcgaaatccgtttactggtcatt
cgtgcacaagggctccttggtcgggtgactgtaggatttagaacagtatccctgacagca
tttagtccagaggactaccagagcactgctggcacattagaatttcaatcaggagaaaga
tataaatatatatttgtcaacatcactgataattccatccctgaactggaaaaatctttt
aaagttgagttgttaaacttggatggaggagtgtctgacctctttagggttgatggcagt
gggagtggagaagcggacacggatttcttccttccacctgtcctcccgcatgccagtcta
ggagtggcttcccagattctggtgaccattgctgcctctgaccatgctcatggggtgttt
gaattcagccctgaatcactcttcgtcagtggaactgaaccagaggatggatacagtact
gtcgtgttaaatgttacacggactcggggagccctgtctgcagtgactttgcaatggaag
gtagactcggacctggatggggatctcgccattacatctggcaacatcacatttgagact
gggcagaggattgcttccatcactgtggagatactgtcagatgaagagccagagctagac
aaggcactcaccgtgtcgatcctcaacgtgtccagtggctccttgggagttcttacaaat
gccacattgacaattttggctagtgatgatccttatggggtctttatttttcctaacaaa
actagacctttgagtgttgaagaagcaacccagaatgtcacattatcgataataaggttg
aaaggcctcatgggagaagttgcagtctcatatgcaaccatagatgatatggaaaagcca
ccgtatttcccacctaatttagctagagcaactcaaggaggagattacatatcagcatct
ggattggctcttttcagagctaatcagactgaggcaacaatcactatttcaatcctagat
gatgctgaaccagaacgctcagaatctgtgttcattgaacttttcaattcctctttagta
gacaaagtacagaatcgcccaatcccacattctccacgccttgggcctaaggtggagact
gtggcccatctcgttattgttgccaatgacgatgcatttggaactgtgcagctgtctgca
acatctgttcatgtagcagaaaatcatgttggacccattatcaatgtgactcgaactgga
ggaacatttgcagatgtttctgttaagtttaaagctgtgccaataactgcagcagcgggt
gaggactatagtatagcatcttcagacgtggtcttgctggaaggggaaaccactaaagct
gtgccaatatatatcattaacgacatctaccctgagctggaagaaacctttcttgtgcag
ctactaaacgaaacaacaggtggagccacactggggcctctgagagaggcagtcattacc
atagaggcgtctgatgacccctacggactgtttggttttcagaatactaaatttattgta
gaggaacctgagtttaactcagtgagggtaaacgtgccaataattcgaaattctgggaca
ctcggcaatgttactgttcaatgggttgccatcattaatggacagtttgctactggcgac
ctgcgagttgtctcaggtaatgtgacctttgcccctggggaaaccattcaaaccttgttg
ttagaggtcctggctgacgacgttccggagattgaagaggttgtccaggtgcaactagct
gctgcctctggcggaggtacaattgggttagatcgagtggcaaatattgttattcctgcc
aatgataacccttacggttcagtagcctttgttcagtccgtttttcgtgtccaagagcct
ctagagagaagttcctatgctaacataactgtcaggagaagcggaggacactttggtcgc
ctgctgttgtgctatggtacttctgatattgatgtagtggctcgtgcagttgaggaaggt
gaagatgtgttatcctactatgaatcaccgactcaaggggtgcccgacccactctggaga
acttgggtgaacgtgtctgcagtggaggagacacagtatacctgtgccactttgtgtctc
aaagaacgtgcctgctcagcgttttcagttgtcagtggtgccgagggccctcggtgcttc
tggatgacgtcgtgggtcagcggaactgtgaacagctctgacttccaaacctacaagaag
aacatgactagggtggcctctcttttcagtggccaggcagttgctggtagtgactacgag
cctgtgacaagacagtgggccgtgatactggaaggtgatgagtttgcaaatctcactgtt
tctgtacttcctgacgatgctcccgagatggatgaaagtttcctaatttctctccttgaa
gttcaccttatgaacatctcagacagttttaaaaaccagccaaccataggacatccgaat
acttccgctgtggtcataggactgaatggcgatgcctttggagtattcattatctacagt
gttagtcccaatacctcggaagatggcttatgtgtggaagtgcaggaacagccacaaact
tctgtggaactggttatctacaggacaggaggcagcctggggcaggtcatggtcgaatgg
cgcgttgttggtggaacggctactgaaggtttagattttatgggtgctggagacattctt
acttttgcagaaggtgaaaccaaaaagatggccattttaaccattttggatgattctgag
ccagaggacaatgaaagcatccttgtccgtctggtggccacagagggcggaagcagaatc
ctgcccagctcagacaccgtgacagtcaacatcttggcaaacgacaatgtggcaggaatt
gtcagctttcagacagcttccagatctgtcataggccacgaaggagaaatgttgcagttc
catgtggtaagaacacccccaggtcgaggaaatgtcactgtcaactggaaagttgttgga
caaaatctagaagtcaattttgctaactttacgggccaactcttcttctctgagggtaca
ttgaataaaacaatatttgtacatttgttggatgacaatattcctgaggagaaagaagta
taccaggttgttctgtatgatgtcaagacccaaggagtgtcgccagcaggagttgctcta
cttgatgcccagggatatgcagctgtactgacagtggaagcaagcgatgagccacacggt
gttttaaactttgctctctcctcaagatttgttgtgctccaggaggctaatgtaacaatt
cagctcttcgtcaacagagagttcggatctctaggagccatcaatgtcacgtatgctact
gttcctggaatagtaagtctgaaaaacaacacagaaggcaacctagcagagccagagtct
gacttcatccctgtggtgggctctctggttttggaggaaggggaaacaacagcagctatc
agtatcactgtcctcgaggatgatataccagagctaaaagaatatttcttggtgaattta
actcatgttgatctcattatggctcctctgacttcatctcctcccagactagattcagaa
ggcctgacggcacagattgtcatagatgccaatgacggtgcccaaggcatgattgaatgg
cagcgtaacagatttgaagtgaatgaaaccgacggcgttgtaacactggtagcgcagagg
agcagagcagcccttggccaggtgtcattgtttatgtatgcccagaacctagaggctcag
gcggggctggattacatgtgcactccacagattcttcacttcactgatggagaaaggttt
aagcatgtggacgtcatgattctggacgatgacatgccagaaggagacgaaagatttcag
ttgctattaacaaatccttctcctggactagagctggggaaaaataccatagctttgatt
actgtccttgccaatgacgatggccctggagttctgtcctttaacaacagcgggcacatc
ttcctcagggaaccgacatctctctacgtgcaggagagtgtagcagtgttagtcattgtt
cgggaaccagctcaaggtctgtttggaacagtggcagttcagtttgttgtgacagaagtc
aactcttcaactgaatcgaaggacctgtctccttccaaaggctttattgttctagaggaa
ggcgttcggtccaagaccctgcgcatctctgccatattagacacggaaccagaaatggac
gagcattttgtctgcaccctgtttaatccaactggaggtgctagactaggggcccatgtt
caaaccttgataacaatttttcaaaaccaggctcctttgggactattcagtatctctgct
gttgaaaatagtgccacctctatagatgttgaagaatccaacaggagtgtgtacctcaat
gtgtcacgtacaaatggccttgacttgactgcgagtgtgcagtgggagacagtatctgag
acagcctttggcatgaggggaatggatgtcgtcttttccatatttcaaagcttttttgac
aagacagcactggactggtgtttctttactgttgaaggctcagtttacggcgtaatgtta
agaaaatcctcattagttgtttatcgatggcaagggacttttgttcctgttgaggactta
aaggtagaaagtcctaaaacttgtgaggcctttaatattggcgtttccccatatcttgtg
attactcatggggaaagaagtggagagaagccttccattaacagtgtgtacatgctcact
gctggattcagattagtcctgatacagacaatcattatttcaggaagctgtcaagtacgg
catttcacctcagacagtcaagactatttcatcattgcaagtcgaagaaatgattccgaa
ttaacccaggtcttcagatggaacggaaacaactttgcctggcatcagacactgcctgtc
cgaggtgtgctgggcatggccttgttcagcagaggaggctctgtcttcttagccatttct
caggctaacatcagacaaacctcccttttgtttacgtggtctggtactcagtttattaac
tttcaagaactgcccatcagtgggataacacaagttgaggctttgtcctcaggcgatgat
gtttatttatgttttgccaaaaatacctttctaggaaatcagaatgcaattgacattttt
gtctgggagatggggcattcatcgttgaggtatttccaatccctggactttgctgctgtt
aagagaatccgttccttcacaccagcttctggcatagtccacatacttctaactgcccaa
gacgggtctgctctttactgctggaactcagagctgaatgccttctctttcgtcctggaa
gcacctgctgcgcacgatgcagcttttgtgacagtgaagtcgcttaattcaagcaagact
ttaattgctttagtgggagccactgactcccatttatatgagttgacctacgtctccagc
cagtctgactttattcctagtttaggtgaactgatatttgaacctggcgacaaggaagca
atcatagcagtaaatgtccttgatgacacagttcccgaaaaagaagaatcattcagagtt
cagcttaaaagtccaagaggcggagcagagattggcattaacagttctgtgagagtcact
gttctcgccaatgatggtgcctatggagttgtagcatttgcccagaactcactgcataag
caattggaggaattggaacgagatagcctggtaacactgaatgttgaacgcttgagagga
acacacggccgcataactgtagcatgggaagcagccggaagtgtcagtgatgtatttccc
acctcaggagtgatctcattcacagaggaccaggcaatgtctatgatcactctgactgtt
cttgcggatgatctgccggagttatccgaggctgtggttgtaacacttacccagattgtc
acagagggggttgaggacccattgaaaggtgctacaattgaccagagcagaagcaggtct
gtgctgaccatcctgcccagtgactcgccctacggtgtggttcgctggcacaccgagtct
ctcttcaatagagtgccagagcccacagagaacatcactgtcgttcagttacatattgtt
cgagacaaaggactatttggggacatttccattcacttgatagcaaaacccaatttctta
ttacatatcaataatcaagctactgaggatgaagattttgtattgcaagactcagtaata
ataatgaaagaaaacataaaagaaactcatgctgaagtcgccattttgccagatgaggtt
cctgagctggatgaaggactcattgtcaccatcgctgcagtgaacctggttaaccccaac
tttcctgcagagcagccccgtgtgcagagaccaaggatggagtcagcggagatactgatt
gaagaaaacgatgatcccagagggatttttaactttcatgttgtcagagatgttggtgga
gtcattattgctcatgaggggcccccgcccttgaatgttcttcaagttcctgttgtccgg
atggctggaacctttgagacagtgaatgtttattggaaagcaacaccagacagtgctggc
ctggaagactttcagccatctcacgggatgctccagtttgctgatggacaagtcatcgca
ccaatacttgtaactataattgatgattctgagtttgagctcttggaaacgttcaccatc
tccctagtgagtgtgactggtggcggccgactaggtgatgatgtttcggtgaatgttgtc
atagcaccgaatgactcgccctttggaatatttggattcgaaaagaaaactgtaatggtt
gatggaccgcttttgtctgatgaccctgattcatatgtgacactgacagtcgtccggtcc
ccaggaggaaaaggagctgtccgacttcactgggctattgaagagaaggccaaagatgac
ctcagtcctttgaatggaacactatattttgatgagactgaatcccagaagtctgttata
ttgcacacacttaaggacggcatggtgggggaagacaggcgcttcattattgagctgaca
gctgctgatgaggtagaaatatctccagtgaaaggtagcgcatcagtcatcatccgagga
gataagagcatatcagaagttggaattgcttcatcatccagacacatcattattggggaa
ccctcagccacatacaatggcactgccatcatcgaccttgttcgtggcccaggggtttca
ggggagatcacagtgaactggaagatattgcctccttccaggggggagtttgtggagaca
tcaggacaactgacgatgctggatggacagactgctgccacagtagttattcaggctttg
aatgatgacatcccagaggagaagtgtcactatgagtttcagctcactgaaatcagtgag
ggtaggatgctgcatgaagccagtgtcagcgcccgcatcaccatggtggccagtgacgct
ccctatggccggttctcattttcacatgagcagcttcacgtttccgaagcagcacagagg
gttaatgtcacagtggtccgctcaggcggctcctttggacgtgcacgagtcttgtatgag
acaggtagcaggacggctgaggcaggctgggactttgttcctgcttctggggagctgctc
tttgaagccagagagaagatgaaaagtctgtacattgacatccttgatgacaaccttcct
gaaggccctgaggaattcgttcttgccattacaagagtggacctccagggaagaggatat
gattttaccatccaagagaatggacttcagatagatcaacctcctgaaattgggaacatc
tccattgttcgaatcataataatgaaaaatgataatgcagaaggcatcattgaatttgat
ccaaagtatactgacatctcagtggaggaagatgccggcgtgatcacactccctgtcctg
aggcttcatggaacgtatggccacgtgtcagctgatttcagctcccggggtttctctgca
gttccaggaggctacgtactgcatggcagctcggtcacctttcagcatggacagaaccta
agctttataaatgtctccatcatcgatgacaatggaagtgaatttgagaagcagtttgaa
attctgctcattggagctacgggaggagcgatccttgggcgccacctagtgagcaaaatc
accattgccaaaagtgactctccctttggcatcatacgatttctcaaccaaagcaaaatt
tctcttcctaaccccagttccacaatggctttacacttggtgctggagcggaccggagga
ctcctgggagagattcaggtgagctgggaggtggtagggcccgatgctgaggaaccgtta
ccgccacacaatggagactttgcagacccagtgagtgggacagtctcttttggagacgga
gaaggtggtgtgagaagcatcatcctcagagtttgtcctcacgaagaaactgaagctgag
gagacttttattgttcagctcaagcctttgagagaagcgaagttagatcccagagctaaa
gctgttacgctaacaatacagaagtttggggatccgaatggagttattcattttgctccc
gagtctttatctaagagaaggttctcagagccacctccgtcggatggacccctgctcgtg
tccttcctcgtcacaaggtccaaaggcacctctggagatatcaaggtgcactgggagcta
agcagcgagtttgacatcactagagactttctttccacacgaggatttttcaccatcgct
gatggagagagtgacgcaagctttgatgtccacttgctgccagatgatgtccctgagata
gaggaggaatacgctgtccagcttgtttctgtagagggaggtgcagaactggacctggga
aaatgcaccgcgaggttctctgtgtctgccaatgacgacccgcatggtgtgtttgccctg
tattcagatcggcagtcagtcctgattggacagaaccttgacagatccatccagattaac
atcacccggctcgctggagcgtttggtgctgtggctgtcagagttcaaatactatctgat
aataaagaagacccagtggctactgaaaatgaagagagacagctggtgatcaccgatggt
gccagatataaagtaggcttggtgcccttgaagaatcaggttttcctatctctgggctct
aatttcaccctgcagttggtgtcagtaaggcttctgagtggacctttctatggaatacca
acaattctccaggaagcgaagaatgctattctctctgttcctgaggaagctgccaattcc
caggttggctttgaatctgctgctttccagctcatggacatcaaggccggcacaagccaa
gtcatggtctccaggaaagggacatacggcaggctctctgtggcctggaccacaggttac
gcccctggctctgaaattcctgagcctattgtcattggcaacatgacaccaaccctgggg
agcctttcttttgtgcatggagaagagaggaagggagtcctgctgtggacatttcccagc
cctggccggccagaggcatttgtccttcatctgtcaggcctgaggagcagtgctgctggt
ggagctcagcttagatcaggtttcactactgctgaaattgaacccatgggagtcttccaa
ttttcccctagttcaagaaatatcacagtgtcagaggatgcacagacgatccgaatatgt
gtgcaaagactctttgggtttcacggtgacctgattaaagtctcctacgagacaactgca
ggaagtgccaagcctccagaggacttcgaagctgttcagaagggggaagtttttttccag
agattccaacctgagattgattttgaaataaccattattaatgatcagcttcctgagata
gaagaaacattttacattaatcttacttcagtagaaaccagggggttggggaaggggggt
gtgaattggagacctcgcctaaatccagatctcagtgtcgcagtggtcaccatagtggac
aatgatgacttgactggggtagctgtttctgtccctgtgacagcagggactgtggcagtt
gacagcactctccttgccatggaaactggttctaccacacaccctaacaaaagcaagata
accaccattccatataccacggaggtgtttgcccctgttacagagacagtaactgtgtct
gccatccctgagaaacttgctactgctcatagtgtcatatctgtgaagcctgatgtggtc
ccaggaactgttcttgcttcagtctatggaaccctgagtatcggaccccccattgtttat
gtgtcagaggaaatgaagaatgggactctcagtactgcagatatccttatccagaggatg
ggtgggttcgcaggcaatgtcaccataacagtgaagactttcggcggaagatgtgctcag
aaggaacccagtgtgtggcccttccaggatgtctatggagttggcaacctaacaacatgg
gcattcgaagaagaagactttgaagaacaattgctcaccctcacattcctctatggggaa
agagaacgtaaaatcgcagttcagattttggacgatgatgagcccgaggggcaggaattc
ttctacgtgtttctcacagaccctcaagggggagcagagattgtgagggggaaggacagc
actgggttttcagcctttgctgtcatcattatctcagggagtgacctccataatggcatc
ataggcttcagtgaggagtcccagagaggcctggaactgagggaaggagctgataaaaac
agccagcgcctagtagtcacaaggcagccaaacagggcctttgaagaagttcagatcttt
tggcgagtcacacttaaccaaacagtcaccattctccaggagaaggggctaaacctaaca
gatgaactccggtttgtggcaggggtcacaacttgcacaggaggtcaaacgcgatgcttt
attcaccttgagctcaaccccaagaaggtgcatcaagttgaaatgcctttctttgtggag
ctgtatgacgtcactgcaggggcagctataaacaacagtgctagatttgctccaattaaa
ctttccaagagcggtgcccctcagagccttgtttccttctctgtgggttctcggctggca
gtggctcacaagaagtctactttgatcagtttgcaggtggccagagattctgggacagga
atcatgatgtctgttaactttattacccaggagctgaggagcgctgaaacagttggtcgg
gtcctcatatctccagctgtttctgggaaggattttgtgaggacagaaggcacattggtc
ttcgagcctggccagaaaagtgcagtgttggatgttgtcttaacaccagaaacagggtct
ttaaataaatttcctaaacgctttcagattgtgctttttgacccaaaaggtggtgccaga
attgataaagtgtatgggactgccaacatcactctcatctctgatgcggattcacaagct
gtctgggggcttgaagacctgctacatcagcccctacatgaagatattctcaacagagtg
ctccataacctcaacctgcgagtagccacagagagcacagatgagcagctcagtgctgtg
atgctcatcatggaaaagataacaatggaaggaagaaatcaagctttcagtatcaaaagc
cgaactcttttgtatgagctcctttgtgttctaattaacccaaagcgcaaagacactagg
ggattcagccactttgtggaggtggctgagcattttgccttttctctgctgactgatgtt
acctgtgggtcgcctggtgaaaaaagcaaaaccatccttgacagttgcccatatctgtca
attctggctcttcactggaaccctcaacagatcaatggacacaagtttgaagggaaggaa
ggtgattacattcaaattccagagaggctactggatgtccctgaggcagaaatgctggat
gggaaaaatgcatgcacattagttcagtttgtggagtacagcagccagcagtggttcata
gcaggagacaaccttcctgccctaaaagacaaggtattgtctttgaatgtgaaaggtcag
agtgcacaacctctgcctaacaacaatgaggttctctacaggattcatgcagctgagcct
agagttgttcctcatacatctcggtgtctcctctggaatcaggcagctgccagctggttg
tctgacagccagttttgcaaagtggttgaagatgcttcggactatgtggaatgtgcctgt
tcacacatgtctgtgtatgctgtctacgcccagactgacaactcgtcgtcatacaatgaa
gcttttttctctgctgggttgatatgcatctcaggtctttgcttggctgttgtttcacac
atgttctgtgcccgacactccatgtttgcagctaagcttctgactcacatgatggtggcc
agcttaggaacccagattttgttcctggcatctgcatatgcaagtccccacctcagcgag
gagagctgctccgctgtggctgctgtggcgcattacctgtatctttgccagtttagctgg
atgctcattcagtctgtgaacttctggtacgtgctggtggtgagtgatgagcacacggag
aggcggtgcctgctcttctgccttctcagctgggggcttccatctttcgtggtgattctc
ctcatacttattttgagaggaatctatcatcggagcatgccgcagatctatggacttatt
catggtgacctatgcttcatcccaaacatctatgctgctctgttcacggctgctcttgtt
cctctaatgtgcctcgtggtggtatttgtggtgttcattcatgcctaccagctgaagccg
cagtggaaaggttatgatgacgtcttcagaggacgaaccaacgcagcagaaattcctctg
attttatatctcttcgccctgatttctatgacgtggctttggggaggactgcatatggcc
tacagacacttctggatgttggttctctttgtcattttcaatagtctgcagggactttat
gtttttgtggtttatttcattttacacaaccaaacgtgttgccctatgaaggccagctat
acagtagaaatgaatggtcacccaggacccagcacagccttcttcactcctgggagcgga
atacctccagctggagagataaacaagtctacccagaacctcatcaatgctatggaagag
gtgccatctgactgggaaagatcatccttccagcagaccagccaggcaagccctgatttg
aagacaagtccccagaatggtgcctcattcccttcttctggaggttatggcccggggtcc
ctgatagccgatgaagagtcccaggagtttgatgacctgatatttgcattaaaaactggt
gctggtctcagtgtcagtgacaacgaatctggtcaaggaagccaggaaggaggcaccctg
actgactcccagattgtagaactcagaaggataccaattgctgacacccacctctga

DBGET integrated database retrieval system