KEGG   Mus musculus (mouse): 110835
Entry
110835            CDS       T01002                                 

Gene name
Chrna5, Acra-5, Acra5
Definition
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 5
  KO
K04807  nicotinic acetylcholine receptor alpha-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110835 (Chrna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    110835 (Chrna5)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   110835 (Chrna5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 110835
NCBI-ProteinID: NP_789814
MGI: 87889
Ensembl: ENSMUSG00000035594
Vega: OTTMUSG00000063246
UniProt: Q2MKA5 Q8BIE9
Position
9 B; 9 29.84 cM
AA seq 438 aa
MQISNAGLPELSSAAKHEDSLFRDLFEDYEKWVRPVEHLSDKIKIKFGLAISQLVDVDEK
NQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTK
TVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDR
TDFFDNGEWEIMSAMGSKGNRTDSCCWYPCITYSFVIKRLPLFYTLFLIIPCIGLSFLTV
VVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIM
VTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAEKDGGPKSR
NTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFLLVSIIGTLGLFVPV
IYKWANIIVPVHIGNTIK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcagatctcgaatgcagggttgcctgagctatcctctgctgcaaaacatgaagacagt
ttgtttagggatttatttgaagactatgaaaagtgggttcgtcctgtggaacacctgagt
gacaagataaaaatcaagtttggccttgcaatatctcagttagtggacgtggatgagaaa
aaccagctaatgaccaccaacgtctggttgaagcaggaatggatagatgtaaagttaaga
tggaatcctgatgactatggtggaataaaaattatacgtgttccttcagactctctgtgg
atcccagacatcgttttgtttgataatgcagacggacgtttcgaaggggccagtacgaaa
acagttgtcaggtacaatggcactgtcacttggacgcagccagcaaactacaaaagttct
tgcactatagatgtgacctttttcccatttgatctccaaaattgctccatgaaattcggc
tcatggacgtatgatggatcccaggtcgatataatcctagaggaccaagatgtcgacaga
acagacttttttgacaatggagaatgggaaatcatgagcgcaatggggagcaaggggaac
cggacggacagctgctgctggtacccctgcatcacctactccttcgtgatcaaacggctg
cctctcttctacaccctgtttcttatcataccctgcatcgggctctcgtttctgactgtg
gttgtcttctatctcccttcaaacgaaggtgaaaagattagcctgtgcacttccgtgctg
gtctctctgactgtcttcctgctggtgattgaggaaattataccgtcatcttccaaagtc
atacctctgatcggggagtacttggtgttcaccatgatcttcgtgaccctatccattatg
gtgactgtctttgccatcaacatccaccaccgctcttcttccacacacaatgctatggcg
ccgtgggttcgtaagatatttctccacaagcttcccaaactgctctgcatgagaagtcat
gccgataggtacttcactcagagagaagaagccgagaaagacggtggacctaaatctcgg
aatactttggaggccgcgctcgattgcattcgctacatcacgagacacgtagtgaaagag
aacgacgtccgcgaggttgttgaagattggaaattcatagcccaagttctcgatcggatg
tttctatggacgtttcttctggtttcaatcattgggacgctagggctttttgttcctgtt
atttataaatgggccaatataatagtcccagttcacattggaaacacaattaagtga

DBGET integrated database retrieval system