KEGG   Mus musculus (house mouse): 110862
Entry
110862            CDS       T01002                                 
Symbol
Kcnq3
Name
(RefSeq) potassium voltage-gated channel, subfamily Q, member 3
  KO
K04928  potassium voltage-gated channel KQT-like subfamily member 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    110862 (Kcnq3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    110862 (Kcnq3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   110862 (Kcnq3)
SSDB
Motif
Pfam: KCNQ_channel KCNQC3-Ank-G_bd Ion_trans Ion_trans_2 Lig_chan DUF6526
Other DBs
NCBI-GeneID: 110862
NCBI-ProteinID: NP_690887
MGI: 1336181
Ensembl: ENSMUSG00000056258
UniProt: Q8K3F6
Position
15:complement(65858223..66158485)
AA seq 873 aa
MGLKARRAAGAAGGGGGEGGGGGGGAANPAGGDSAVAGDEERKVGLAPGDVEQVTLALGA
GADKDGTLLLEGGGREEGQRRTPQGIGLLAKTPLSRPVKRNNAKYRRIQTLIYDALERPR
GWALLYHALVFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAG
CCCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLR
MDRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEMDAQGEEMKEE
FETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKV
QEQHRQKHFEKRRKPAAELIQAAWRYYATNPNRLDLVATWRFYESVVSFPFFRKEQLEAA
ASQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMK
AYAFWQSSEDAGTGDPMAEDRGYGNDFLIEDMIPTLKAAIRAVRILQFRLYKKKFKETLR
PYDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTYPSQQSP
RNEPYVARAATSETEDQSMMGKFVKVERQVHDMGKKLDFLVDMHMQHMERLQVHVTEYYP
TKGASSPAEGEKKEDNRYSDLKTIICNYSETGPPDPPYSFHQVPIDRVGPYGFFAHDPVK
LTRGGPSSTKAQANLPSSGSTYAERPTVLPILTLLDSCVSYHSQTELQGPYSDHISPRQR
RSITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPSGGSSWMREKRYLAEGETD
TDTDPFTPSGSMPMSSTGDGISDSIWTPSNKPT
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgggtctcaaggctcgcagggcggcgggggcggctggcgggggcggcggcgaagggggc
ggcggcggcggcggggccgctaaccctgctggaggggactcggcggtggccggcgacgag
gagcggaaagtggggctggcgccaggagacgtggagcaagtcaccttggcgctaggggcc
ggagccgacaaagacgggaccctgctgctggagggcggtggccgcgaagaggggcagagg
aggaccccgcagggcatcgggctcctggcaaagacccccctgagccgcccagtcaagagg
aacaacgccaagtacaggcgcatccaaactttgatctatgacgccctggagagaccgcgg
ggctgggcgctgctctaccacgcgcttgtgttcctgattgtcctgggatgcttgattctg
gccgtgctcaccaccttcaaggaatatgagactgtgtctggagactggcttttgctgctg
gaaacctttgctattttcatctttggagctgagtttgctttgaggatctgggctgcagga
tgttgctgtcgatacaaaggctggcgtggacggctaaagtttgccaggaagcccctgtgc
atgttggacatcttcgtactgattgcctctgtgccagtggttgccgtgggaaaccagggc
aatgtcttggccacctccctgcgaagccttcgcttcctgcagatcctgcgcatgcttcga
atggataggaggggtggcacctggaagctcctgggctcggctatctgtgcccacagcaaa
gaactcatcactgcctggtacataggcttcctgacactcatcctttcttcatttcttgtc
tacctggtggagaaggatgtgccagagatggatgcccaaggagaggaaatgaaggaggag
tttgagacctatgcagatgctctgtggtggggcctgatcacactggccaccattggttat
ggagacaagacacctaaaacctgggaaggacgtctgattgctgccaccttttctttaatc
ggcgtctccttttttgcccttccggcaggcatccttggctcaggactggcactgaaggtt
caggagcagcaccgtcagaagcactttgagaagagaaggaagccagctgcggaactcatc
caggctgcctggagatattatgctaccaaccccaacaggttggatctggtggcaacctgg
agattttatgaatcagttgtctctttcccattcttcaggaaagaacaactggaagcagca
gccagccaaaagctgggtctcttggatcgggttcgcctttctaatcctcgtggtagcaat
actaaaggaaagctatttacccctctgaatgtagatgccatagaagaaagcccttccaaa
gagccaaagcctgttggcttaaacaataaagagcgtttccgcaccgccttccgcatgaaa
gcctacgctttctggcagagttctgaagatgctgggacaggcgaccccatggcagaagac
aggggctatgggaatgacttcctcattgaagacatgatccctaccctaaaggctgccatc
cgagctgtcagaattctacagttccgtctatataaaaaaaagttcaaggagacgttgagg
ccttatgatgtgaaagatgtgattgagcagtattcggccggacatcttgacatgctttcc
aggataaagtacctacagacaagaatagatatgattttcacccctggacctccatccact
ccaaaacataagaagtctcagaaagggtcagcatttacctacccatcccagcagtctcca
aggaatgaaccatatgtagccagggcagccacatcagaaactgaagaccaaagcatgatg
gggaagtttgtaaaagttgaaagacaggttcatgacatggggaagaaactggacttcctc
gtggacatgcatatgcagcatatggaacgcttacaggtacatgtcactgagtactaccca
actaagggggcctcctccccagccgaaggggagaagaaagaagacaacaggtactctgat
ttgaaaaccatcatctgcaactactcagagacagggccccctgaccctccttacagcttc
caccaggtgcccatcgacagagttggcccttacgggttttttgcacatgatcctgtgaaa
ctgacccgagggggacccagttctacaaaggctcaagctaaccttccctcctcgggaagt
acatatgcagagaggcccacagtcctgcccatcttgactcttctggactcatgtgtgagc
taccactcccagacagaactgcaaggtccctattcggaccacatctcgccccgccagaga
cgcagcatcactagggacagtgatacacctctgtccctcatgtccgtcaatcacgaggaa
ctggagcggtctccaagtggcttcagcatctcacaagacagagatgattatgtatttggc
cccagtgggggatcgagctggatgagggaaaagcggtacctggctgaaggagaaacggac
acggacacagaccccttcacacccagtggttccatgcctatgtcatccactggggatggt
atttcagattccatatggaccccttccaacaagcccacttaa

DBGET integrated database retrieval system