KEGG   Mus musculus (mouse): 110876Help
Entry
110876            CDS       T01002                                 

Gene name
Scn2a, 6430408L10, A230052E19Rik, Nav1.2, Scn2a1
Definition
(RefSeq) sodium channel, voltage-gated, type II, alpha
  KO
K04834  voltage-gated sodium channel type II alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    110876 (Scn2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    110876 (Scn2a)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   110876 (Scn2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel ATP-synt_B GPHH IQ
Motif
Other DBs
NCBI-GeneID: 110876
NCBI-ProteinID: NP_001092768
MGI: 98248
Ensembl: ENSMUSG00000075318
Vega: OTTMUSG00000012963
UniProt: B1AWN6
Position
2 C1.3; 2 38.61 cM
AA seq 2006 aa AA seqDB search
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRK
LAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSL
DWNGTAFNRTMNMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQAGEEEKEDAVRKSASEDSIRKKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFKGRVKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRPSNVSQASRASRGIPTLPMNGKMHSAVDCNGVVSLVGGP
SALTSPVGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSMASILTNTMEELE
ESRQKCPPCWYKFANMCLIWDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELG
LANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKR
KIREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIG
SSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATS
SSEGSTVDIGAPAEGEQPEAEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRK
TCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLL
KWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSR
FEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSV
VNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVEL
QPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYN
AMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEM
TNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYF
VSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGM
SNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPG
SSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFY
EVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILF
AFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRY
LLKQKVKKVSSIYKKDKGKEDEGTPIKEDIITDKLNENSTPEKTDVTPSTTSPPSYDSVT
KPEKEKFEKDKSEKEDKGKDIRESKK
NT seq 6021 nt NT seq  +upstreamnt  +downstreamnt
atggcacaatcagtgctggtaccgccaggacctgacagcttccgcttctttaccagggaa
tcccttgctgctattgaacaacgcattgcagaagagaaagctaagagacccaaacaggaa
cgcaaggacgaagacgacgaaaatggcccaaagccaaatagtgacttggaagcaggaaaa
tcccttccttttatttatggagacattcctccagagatggtgtcagagcccctggaggac
ctggacccctactatatcaataagaaaacctttatagtattgaataaagggaaagcaatc
tctcggttcagtgccacctccgccctgtacattttaactcccttcaaccccattagaaaa
ttagctattaagattttggtacattctttattcaatgtgcttatcatgtgcacaattctt
accaactgtgtatttatgaccatgagcaaccctccagactggacaaagaatgtggagtat
acttttacaggaatttatacttttgaatcacttattaaaatacttgcaaggggcttttgt
ctagaagatttcacatttctacgggatccctggaactggctggatttcacagtcattacc
tttgcgtatgtaacagaatttgtaaacctaggcaatgtttcagctcttcgaactttcaga
gtcttgagagctttgaaaactatttctgtaattccaggcctgaagaccatcgtgggggcc
ctgatccagtcggtgaagaagctgtctgacgtcatgatactcactgtgttctgtctgagt
gtctttgctctcatcgggctgcagctcttcatgggcaacctgaggaataaatgcttgcag
tggcccccagacaattctacctttgaaataaacatcacttccttctttaataactcattg
gattggaatggtactgccttcaataggacaatgaacatgtttaactgggatgaatatatt
gaagataaaagtcacttttattttttggaaggacaaaacgatgctctgctttgtggtaac
agctcggatgctggccagtgtccggaaggatacatctgtgtgaaggctgggagaaacccc
aactatggctacacgagttttgacaccttcagctgggccttcttgtccttatttcgtctt
atgactcaagacttctgggaaaacctttatcagctgaccttgcgtgctgctgggaaaaca
tatatgatatttttcgtgcttgtgattttcttgggctcattctacctaataaatttgatc
ctggctgtggtggccatggcctatgaagaacagaaccaggccacgctggaggaagctgaa
cagaaggaggcagagtttcagcagatgctggagcaacttaagaagcagcaagaagaagct
caggcagcagctgcagcagcgtctgcagaatccagagacttcagtggagcaggtgggata
ggtgttttctcggagagttcttccgtagcttcaaagttaagttccaagagtgaaaaggag
ctgaaaaacagaaggaagaaaaagaaacagaaagagcaggctggagaggaagagaaggaa
gatgctgtgcggaaatctgcctctgaagacagcatacgaaagaaaggcttccggttttcc
ctagaagggagtagactgacctacgagaagaggttttcctctccacaccagtctctcttg
agcatccgaggctcccttttttctccgagacgcaacagtagagcaagccttttcagcttc
aaaggtcgggtgaaggatattggttctgaaaatgactttgcggacgatgaacacagcacg
tttgaggacaacgacagcaggagagactctctatttgtaccacacagacatggagaaagg
cgtcccagcaacgttagccaggccagccgtgcctcccgggggatacccactctacccatg
aatgggaagatgcacagtgcagtggactgcaacggtgtggtctccctagttggaggccct
tctgctctcacatctcctgtggggcagctactaccagagggcacaactactgaaacagaa
ataaggaagaggaggtccagttcttaccatgtttctatggacttgttggaagaccctaca
tcaaggcaaagagcaatgagtatggccagcattttgaccaacactatggaagaacttgaa
gaatccagacagaaatgccctccatgctggtataaatttgctaatatgtgcctgatttgg
gactgttgtaagccatggctaaaggtaaaacatgttgtcaatctggtagtgatggatcca
ttcgttgacctggccatcaccatctgcattgtgttaaatacactcttcatggccatggag
cactacccgatgacggagcagttcagcagtgtgctgtctgttgggaatttggtcttcact
gggatcttcaccgcagaaatgtttctcaagataatagccatggatccatattattacttt
caagaaggctggaatatctttgatggctttatagtgagccttagtttaatggaactcggc
ttggcgaatgtggaaggactgtcagttctccgatctttccgactgcttagagtcttcaag
ttggcaaaatcctggcccacactgaatatgctcattaagatcatcggcaactcggtgggc
gcgctgggcaacctgaccctggtgctggccatcatcgtcttcatttttgccgtggtcggc
atgcagctgtttggaaagagctacaaggagtgtgtttgcaagatttccaatgattgtgag
ctgccgcgctggcacatgcatgacttcttccactcgttcctgatcgtgttccgcgtgctg
tgtggggagtggatagagaccatgtgggactgcatggaggtcgcaggccagaccatgtgt
cttactgtcttcatgatggtcatggtgattgggaaccttgtcgttctgaacctcttcttg
gccttgctcctcagttctttcagctcggacaacctggctgccacagatgacgataacgaa
atgaacaacctccagatagccgtgggaaggatgcagaaggggattgattttgttaaaagg
aagatacgtgaattcattcagaaagcctttgtcagaaagcagaaagctctagatgaaatc
aaaccccttgaagatctgaataacaagaaagacagttgtatctccaaccacacaaccata
gaaataggcaaggacctgaattacctcaaagatggaaacgggacgaccagtggcataggc
agcagtgtggagaagtacgtggtagatgagagtgattacatgtcattcatcaacaacccc
agcctcaccgtgactgtgcccattgctgtgggagagtctgactttgaaaacttaaataca
gaagaattcagcagtgaatcagatatggaagaaagcaaggagaaattgaatgcaactagt
tcatctgaaggcagtacagttgatataggtgctcctgcagagggagagcaaccagaggcc
gaaccagaagagtcccttgagccagaagcctgtttcacagaagactgtgtaagaaagttc
aagtgttgtcagataagcatagaagaaggcaaaggcaaactctggtggaacttgaggaaa
acctgctacaagatagtagagcacaactggtttgaaaccttcatcgtcttcatgattctg
ctcagcagcggtgctctggcctttgaagacatttacatcgagcagcgaaaaaccatcaag
accatgctggagtatgctgacaaggtcttcacttacatcttcatcctggagatgttgcta
aagtgggttgcatatggtttccaaatgtacttcaccaatgcctggtgctggctggacttc
ctgatcgttgatgtctcactggttagcttaactgcaaatgccttgggctattcagaactt
ggtgccatcaaatccctccgaacattaagagcactgaggcctctacgagccttatcccga
tttgaaggaatgagggttgttgtaaacgctctcctaggtgcaatcccatccataatgaac
gtacttctggtctgcctgatcttttggctaatattcagtatcatgggggtgaatctcttt
gccggcaagttctatcattgcatcaactacaccaccggggaaatgtttgatgtgagcgtg
gtcaacaactacagtgagtgccaggctctcatagagagcaatcagacagccaggtggaag
aatgtgaaagtcaactttgacaacgtgggacttggatatctttctctgcttcaagtagcc
acatttaaaggatggatggatatcatgtatgcagctgttgactcaagaaatgtagaactg
caacccaaatatgaagacaatctatacatgtacctttactttgtcatctttattattttc
ggctcattcttcacactgaacctgttcatcggcgtcatcatagataacttcaaccaacag
aagaagaagtttggaggtcaagacatttttatgacagaagaacagaagaaatactacaat
gcaatgaagaagctaggctcaaagaaaccacaaaaaccgatacctcgccctgctaacaag
tttcaagggatggtctttgattttgtaaccaaacaagtgtttgacatcagcatcatgatc
ctcatctgcctcaacatggtgaccatgatggtggaaacggacgaccagagccaagagatg
accaacatcctgtattggatcaacctggtgttcatcgtcctgttcaccggcgagtgtgtg
ctcaagcttatctcactccgtcattattatttcaccattggatggaacatttttgatttt
gtggtggtcatcctctccattgtagggatgtttctcgcggagctgatagagaagtatttc
gtgtcccctaccctgttccgagtcatccgcctggccaggattggacgaatcctacgcctg
atcaaaggcgccaaggggatccgcacgctgctctttgctctgatgatgtcccttcctgcg
ctgtttaacatcggcctcctgcttttcctggtcatgttcatctacgccatctttgggatg
tccaactttgcctacgttaagagggaagttgggattgatgacatgttcaactttgagacc
tttggcaacagcatgatctgcctgttccaaatcaccacttctgcgggctgggatggactg
ctggcccctatactaaatagtggacctcccgattgtgaccctgaaaaagatcatcctgga
agctcggtgaagggagactgtgggaacccatctgtggggattttcttttttgtcagctac
atcatcatatccttcctggttgtggtgaacatgtacattgctgtcatcctggagaacttc
agcgttgccacagaagaaagtgcagagcctctgagtgaggacgactttgagatgttctac
gaagtctgggagaagttcgaccctgacgccacccagttcatagagttctgcaagctctct
gactttgcagctgccctggatcctcccctcctcatcgcaaagccaaacaaagtgcagctc
attgccatggacctgcccatggtgagtggagaccgcatccactgcctggacatcttattt
gcttttacaaagcgggtcctgggtgagagtggagagatggatgctcttcgaatccagatg
gaagagcggttcatggcttccaatccctccaaggtctcttatgagcccattaccaccact
ctgaagcgcaaacaagaggaggtgtctgctattgtcatccagcgagcttacagacgctat
cttctgaaacagaaagttaagaaggtttcgtctatatataaaaaagacaagggtaaagaa
gatgagggaacgcccatcaaagaagacatcatcacggataaactgaatgagaattcaact
ccagagaagactgacgtgacaccctccaccacttcgccaccttcctacgatagcgtgacc
aaaccggagaaggaaaaatttgaaaaggacaaatcagaaaaagaggacaaggggaaagat
atcagggaaagtaaaaagtaa

DBGET integrated database retrieval system