KEGG   Mus musculus (mouse): 110886Help
Entry
110886            CDS       T01002                                 

Gene name
Gabra5, A230018I05Rik
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110886 (Gabra5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    110886 (Gabra5)
   04723 Retrograde endocannabinoid signaling
    110886 (Gabra5)
  09157 Sensory system
   04742 Taste transduction
    110886 (Gabra5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    110886 (Gabra5)
   05033 Nicotine addiction
    110886 (Gabra5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    110886 (Gabra5)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   110886 (Gabra5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Motif
Other DBs
NCBI-GeneID: 110886
NCBI-ProteinID: NP_795916
MGI: 95617
Ensembl: ENSMUSG00000055078
Vega: OTTMUSG00000058873
UniProt: Q8BHJ7
Position
7 B5; 7 33.52 cM
AA seq 463 aa AA seqDB search
MDNGMLSRFIMTQTLLVFCISMTLSSHFGFSQMPTSSVQDETNDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA
KIKKKERELILNKSTNAFTTGKLTHPPNIPKEQPPAGTANAPTVSIKASEEKTAESKKTY
NSISKIDKMSRIVFPILFGTFNLVYWATYLNREPVIKGATSPK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggacaatggaatgctctctagatttatcatgacccaaaccctccttgtcttctgtatt
tccatgaccttatccagtcactttggcttttcgcaaatgccaactagttctgtacaagac
gagaccaatgacaacatcacaatattcaccaggatcttggacggactcttggatggctat
gacaacagactgcggcctgggctgggagagcgaatcacgcaggtgcgaacagacatctat
gttaccagctttggcccagtgtctgacacggaaatggaatataccatcgatgtgtttttc
cggcaaagctggaaagatgaaaggctgcggtttaagggccccatgcaacgcctccctctc
aacaaccttcttgccagcaaaatctggactccagacacgttcttccacaacggcaagaag
tccattgcacacaacatgacgacacccaacaagctgctgaggctggaggatgatggcaca
cttctctacaccatgcgtctgacaatctctgctgagtgcccaatgcagcttgaggacttt
ccaatggatgcccatgcctgtcccctgaaatttggcagttatgcttaccctaattctgaa
gttgtctatgtttggaccaatggctccaccaagtctgtggtggtggcagaagatggctcc
aggctcaaccagtaccacctcatggggcagacagtaggcactgagaacatcagcaccagc
acaggtgaatatacgatcatgactgctcacttccacctgaagaggaagataggctacttt
gtcatccagacctaccttccctgcatcatgactgtcatcttatcccaggtgtccttttgg
ctaaatcgagaatctgtcccagctaggacagtttttggagtgaccacagtgctgaccatg
acaacactcagcatcagtgcccggaattcgctgcccaaagtggcctatgccacagccatg
gactggttcattgctgtctgctatgcatttgtcttctctgctctgattgaatttgccaca
gtcaactactttacaaagagaggatgggcctgggatggcaagaaagccctggaagcagct
aaaataaagaaaaaagaacgcgaactcatactaaataagtcaacaaatgcttttacaact
ggaaagctgacccatcctccaaacatcccaaaagagcagcctccagctgggaccgcgaat
gcacccacagtctccatcaaagcttctgaagagaagactgcggagagtaaaaagacatac
aacagcatcagcaagatcgacaaaatgtcccggattgtgttccccatcttgtttggcact
ttcaacttagtttactgggcaacatatttgaatagagagcccgtgataaaaggggccacc
tctccaaagtaa

DBGET integrated database retrieval system