KEGG   Mus musculus (mouse): 110902
Entry
110902            CDS       T01002                                 

Gene name
Chrna2, Acra-2, Acra2, BC011490
Definition
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal)
  KO
K04804  nicotinic acetylcholine receptor alpha-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110902 (Chrna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    110902 (Chrna2)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   110902 (Chrna2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417 PTPRCAP
Other DBs
NCBI-GeneID: 110902
NCBI-ProteinID: NP_659052
MGI: 87886
Ensembl: ENSMUSG00000022041
Vega: OTTMUSG00000039812
UniProt: Q91X60
Position
14 D1; 14 34.36 cM
AA seq 512 aa
MAPSHPAFQFWIHLYLWCLLLMPAVLAQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDV
VIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIP
DIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGS
WTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRR
LPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSL
VIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRP
LPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLY
GHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVA
MVVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggccccctcccatcctgctttccagttctggatacatctttatctctggtgtctgctt
ctgatgccagcagtgttggcccagcaaggctcgcacacccatgccgaggaccgcctgttc
aaacacctctttggaggctacaatcgctgggcacggccagtgcccaacacttccgatgtg
gtcatcgtgcgctttggactatccattgcacagctcatagatgtggatgagaagaatcaa
atgatgaccaccaatgtctggctaaagcaggaatggaatgactacaagctgcgctgggac
ccggctgagtttggcaacatcacctccctccgcgtcccctcagagatgatctggatccca
gacattgttctctacaacaatgcagacggggagtttgcggtgacccacatgaccaaggcc
cacctcttcttcacgggcactgtgcactgggtgcccccagccatctacaagagctcctgc
agcatcgacgtgactttcttccccttcgaccagcagaactgcaagatgaagtttggctcc
tggacatacgacaaggccaagatcgacctggagcagatggagcggacggtggacctgaag
gactactgggagagcggcgagtgggccattatcaacgccaccggaacctataacagcaag
aagtacgactgctgcgcggagatctaccccgacgtcacctactacttcgttatccgccgg
ctgccgctgttctacaccatcaacctcattatcccgtgcctgctcatctcctgcctcacc
gtgctcgtgttctacttgccctctgagtgtggagagaagatcacgctgtgcatctcggtg
ctgctctccctcactgtcttcctgctgctcatcacagaaattatcccatccacctcactg
gtcatcccactcatcggcgagtacctgctcttcaccatgatcttcgtcaccctctctatt
gtgatcacagtcttcgtgctcaatgtccaccaccgttcccctagcacgcacaacatgccc
aactgggtgagggtggccctgctaggccgggtgccccggtggctgatgatgaatcggccc
ctgccgcccatggagctccatggctctccaggtctgaagctcagccccacttatcattgg
ctggagaccaacatggatgctgaagaaagggaggagacagaggaagaggaggaggaggaa
gaagatgaaaacatatgtatgtgtgcaggcctcccagactcttccatgggtgtcctctat
ggccatggcagcctgcatctgagggccatggggcctgaggccaagactccatcccaggct
agtgagatcctgctgtcacctcaaatacagaaagcactagaaggtgtacactacattgct
gaccacctgaggtctgaggatgctgactcttcggtgaaggaagattggaagtatgtggcc
atggtggtagaccggatcttcctctggctgttcattatcgtctgcttcctggggaccatc
gggctcttcctccctccgttcctggctggaatgatctga

DBGET integrated database retrieval system