KEGG   Mus musculus (mouse): 110957
Entry
110957            CDS       T01002                                 

Gene name
D1Pas1, Pl, Pl10
Definition
(RefSeq) DNA segment, Chr 1, Pasteur Institute 1
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu05161  Hepatitis B
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    110957 (D1Pas1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110957 (D1Pas1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110957 (D1Pas1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    110957 (D1Pas1)
   03041 Spliceosome [BR:mmu03041]
    110957 (D1Pas1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    110957 (D1Pas1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110957 (D1Pas1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     110957 (D1Pas1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     110957 (D1Pas1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    110957 (D1Pas1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    110957 (D1Pas1)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 110957
NCBI-ProteinID: NP_149068
MGI: 91842
Ensembl: ENSMUSG00000039224
Vega: OTTMUSG00000029142
UniProt: P16381 B9EIA2
Position
1 H5; 1 90.09 cM
AA seq 660 aa
MSHVAEEDELGLDQQLAGLDLTSRDSQSGGSTASKGRYIPPHLRNREAAKAFYDKDGSRW
SKDKDAYSSFGSRSDTRAKSSFFSDRGGSGSRGRFDERGRSDYESVGSRGGRSGFGKFER
GGNSRWCDKADEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIES
FSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQ
IYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVY
GGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQI
RRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVW
VEEADKRSFLLDLLNATGKDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDRE
EALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLA
TSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFEHHYKGGSRGRSKSRFSGGFGARDY
RQSSGASSSSFSSGRASNSRSGGGSHGSSRGFGGGSYGGFYNSDGYGGNYSSQGVDWWGN
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcagaggaagatgagctcgggctggaccagcagttggctggcctagac
ctgacgtctcgggacagccagagcgggggcagcacagccagcaaagggcgctacatcccc
cctcacctgcggaaccgggaggccgcgaaggcgttctacgacaaagacggctcacggtgg
agtaaagacaaggatgcctacagcagcttcgggtcccgcagcgacacgagagccaagtcc
agtttcttcagtgaccgcggcggaagcggctccaggggaaggtttgacgagcgcgggcgg
agtgactacgagagtgttggcagccggggaggtagaagtggctttggcaaatttgagcgg
ggcgggaacagtcgctggtgtgacaaagcagacgaggatgactggtcgaaaccgctccca
ccaagcgaacgcttggaacaggaactcttttccggaggcaacactgggattaactttgag
aaatatgatgacatcccggttgaggcgacagggaataactgccctccacatattgaaagt
ttcagcgatgtcgagatgggagagattattatgggaaacatcgagctcactcgttacaca
cgcccaactcctgtgcaaaagcatgctattcctattatcaaggagaaaagagacttgatg
gcttgtgcccaaacggggtctggaaaaacagcagcttttcttctacctatcttgagtcag
atctatacggatggtccaggtgaggctttgagggccatgaaggagaatggaaagtatggg
cgtcgcaaacagtatccaatctccttggtcttggctccgaccagagaattggccgtgcag
atctatgaggaggccaggaaattctcataccgctctcgagttcgtccttgtgtggtttat
ggtggagctgatattgggcagcagattcgagacttggaacgtggctgtcacttgttagta
gctactccaggacggctagtagatatgatggagagaggaaagattggactggacttctgc
aaatacttggtgttagatgaagcagatcgaatgttggacatgggctttgagcctcagata
cgaagaatagttgagcaagacaccatgcctccaaaaggtgtccgccacactatgatgttt
agtgctacctttcctaaggaaatacagatgctggctcgggatttcttggatgaatatatc
tttctggccgtaggaagagttgggtctacttctgagaacatcacacagaaagtcgtgtgg
gtggaagaagcagacaagcggtcatttctgcttgacctcctgaatgcaacgggcaaggat
tccctgatattggtgtttgtggaaaccaaaaagggtgcagattctctggaggacttctta
taccacgaaggatatgcttgtaccagtatccatggagaccgatctcagcgagatagggaa
gaggcccttcaccaattccgatcaggaaaaagcccaattctcgtggctacagcagtagct
gcaagaggactggatatttccaatgtgaaacatgtcatcaatttcgacttgcctagtgac
atcgaagaatatgtgcatcgcattggccgtacaggtcgtgttggaaaccttggccttgcc
acctcattcttcaacgagaggaacataaatattaccaaagatttattggatcttcttgtt
gaagcaaaacaagaagtgccatcttggctagaaaacatggcttttgaacaccattacaag
ggtggcagtcgtggacggtccaagagcagatttagtggaggatttggtgctagagactat
cgacaaagtagcggtgccagcagttccagcttcagcagtggccgtgctagcaacagtcgc
agcggtggaggcagccatggcagcagcagagggtttggtggaggtagctatggaggcttt
tacaacagtgatggatatggaggaaattatagctcccagggggttgactggtggggtaac
tga

KEGG   Mus musculus (mouse): 13205
Entry
13205             CDS       T01002                                 

Gene name
Ddx3x, D1Pas, D1Pas1-rs2, Ddx3, Fin, Fin14
Definition
(RefSeq) DEAD box helicase 3, X-linked
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu05161  Hepatitis B
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    13205 (Ddx3x)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    13205 (Ddx3x)
  09172 Infectious disease: viral
   05161 Hepatitis B
    13205 (Ddx3x)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    13205 (Ddx3x)
   03041 Spliceosome [BR:mmu03041]
    13205 (Ddx3x)
   03036 Chromosome and associated proteins [BR:mmu03036]
    13205 (Ddx3x)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     13205 (Ddx3x)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     13205 (Ddx3x)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     13205 (Ddx3x)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    13205 (Ddx3x)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    13205 (Ddx3x)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII UTP25
Other DBs
NCBI-GeneID: 13205
NCBI-ProteinID: NP_034158
MGI: 103064
Ensembl: ENSMUSG00000000787
Vega: OTTMUSG00000017078
UniProt: Q62167 Q3TQX5
Position
X A1.1; X 8.17 cM
AA seq 662 aa
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGW
SSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDYDGIGGRGDRSGFGKFE
RGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIE
SFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILS
QIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVV
YGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQ
IRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDR
EEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGL
ATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFEHHYKGSSRGRSKSSRFSGGFGAR
DYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGGGGYGGFYNSDGYGGNYNSQGVDWW
GN
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgagtcatgtggcagtggaaaatgcgctcgggctggaccagcagtttgctggcctagac
ctgaactcttcagataatcagagtggaggaagtacagcaagcaaagggcgttatatccca
cctcatttaaggaacagagaagctactaaaggattctatgacaaagacagttcagggtgg
agttctagtaaagataaggatgcatacagcagttttggatcacggggtgattcaagaggg
aagtctagcttctttggagatcgtggaagtggatcaaggggaaggtttgatgatcgtgga
cggggagactatgatggcattggtggccgtggagatagaagtggctttggcaaatttgaa
agaggtggaaatagtcgctggtgtgacaaatcagatgaagatgactggtcaaagccactc
ccaccaagtgaacgattggaacaggaactcttttctggaggcaatactgggattaacttt
gagaaatatgatgacattccagtcgaagcaacaggcaacaactgtcctccacacattgaa
agtttcagtgatgtcgagatgggagaaattattatgggaaacattgagcttactcgttat
actcgcccaactccagtgcagaagcatgctattcctattatcaaagagaaaagagacttg
atggcttgtgctcaaacaggctctggaaaaactgcagcatttctcttgcccatcttgagt
cagatctatgctgatggtccaggagaagctctgagggctatgaaggaaaatggaagatat
ggccgtcgtaaacagtatccaatctctttggtactggcaccaacgagagaattggcagtg
cagatctatgaggaagccagaaaattctcataccgatctagagtccgtccttgcgtggtt
tatggtggtgctgaaattggccagcagattcgagacttagaacgtggatgccacttgtta
gtagccactccaggacgtctagtggatatgatggagagagggaagatcgggttagacttc
tgcaaatacctggtgttagatgaagctgaccggatgttagatatggggtttgaacctcag
atacgaagaatagttgaacaagacactatgcctccaaaaggtgtccgccacactatgatg
tttagtgctacttttcctaaggaaatacagatgctggcccgtgatttcttagatgagtac
atatttctggctgtaggaagagttgggtctacttcagagaacatcacacaaaaagtggtt
tgggtggaggagatagacaaaaggtcatttctgcttgaccttctaaatgcaacaggcaag
gattccctgactctagtgtttgtggagaccaaaaagggggcagattcgctggaggatttc
ttataccatgaaggatatgcttgtaccagtatccatggagaccgttctcagagagatagg
gaagaggcccttcaccagttccgctcaggaaaaagcccaattctagtggctacagcagta
gcagcaagaggactggatatttcaaatgtgaagcatgttattaattttgacctgcctagt
gatatcgaagaatatgtgcatcgcataggccgtacaggccgtgtgggaaaccttggtctt
gccacctcattctttaatgaaaggaatataaatatcacaaaggatttactggatcttctt
gttgaagcaaaacaagaagtgccttcttggttagagaacatggcttttgaacaccactac
aagggtagcagtcgtggacgttctaagagcagtcgatttagtggagggtttggtgccaga
gactaccgacagagtagcggtgccagcagttccagcttcagcagcagccgtgcaagcagc
agtcgaagtggtggaggtggccatggcggcagtcgaggatttggtggaggtggctacgga
ggcttttacaacagtgatggatatggagggaattataactcccagggggttgactggtgg
ggtaactga

DBGET integrated database retrieval system