KEGG   Mus musculus (mouse): 110959
Entry
110959            CDS       T01002                                 

Gene name
Nudt19, D7R, D7Rp, D7Rp2, D7Rp2-r, D7Rp2-s, D7Rp2e, RP, RP2-r, RP2-s
Definition
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 19
  KO
K13355  nucleoside diphosphate-linked moiety X motif 19, mitochondrial [EC:3.6.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110959 (Nudt19)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     110959 (Nudt19)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 110959
NCBI-ProteinID: NP_149071
MGI: 94203
Ensembl: ENSMUSG00000034875
Vega: OTTMUSG00000026112
UniProt: P11930
Position
7 B2; 7 21.37 cM
AA seq 357 aa
MSSSSSWRRAATVMLAAGWTHSSPAGFRLLLLQRAQNQRFLPGAHVFPGGVLDAADSSPD
WVRLFAPRHTPPRFGLGPEPPRQPPFPGLSHGDADPAALPDDVALRICAIREAFEEAGVL
LLRPRDAAPASQEPSQALSPPAGLAEWRSRVRSDPRCFLQLCAHLDCTPDIWALHDWGGW
LTPYGRTIRRFDTTFFLCCLRDIPRVEPDVAEVVGYQWLSPSEATECFLSKEIWLAPPQF
YEMRRLENFASLSALYRFCSDRPSEVPEKWLPIILLTSDGTIHLLPGDELYVKDSDFLEK
NMSTDKKTEEIVKEGKVLNRVVIHSPYVYEIYMTLPSENKHVYPRNYIVNKRCTAHL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgagcagctcgagcagctggcggcgggcagccaccgtgatgttggcagcaggctggacc
cactcgagcccggccggcttccggctgctgcttctccagcgagcacaaaaccagcgcttc
ttgcccggcgcgcacgtcttcccgggcggcgtgctggacgcggccgacagctcacccgac
tgggtgcgtctgttcgcgcctcggcacacgccgccgcgcttcggcctaggcccggagccc
cctcggcaaccccccttccccgggctgtcccacggcgacgcggaccccgcggcgctgccc
gatgacgtagcgctgcgcatctgtgccatccgcgaagccttcgaggaggcgggggtgctg
ctcctgcggccgcgggacgcggctccagcttctcaggagcccagtcaggcgctgtcgcct
ccggccggcctggccgaatggcgctcgcgcgtgcgcagtgacccgcgctgcttcctccag
ctgtgtgcgcacctagactgcacgcctgacatctgggcgctgcacgactggggcggatgg
ctcaccccgtatgggcgaaccatccgccgtttcgacaccaccttcttcctgtgctgcctg
cgcgacattccgcgcgtggagcccgacgtggccgaggtggtgggctaccagtggttgtcc
ccatcagaggcaactgaatgtttcctatcaaaagaaatctggctggcaccaccacagttc
tatgaaatgagaagacttgaaaactttgcctctctctctgctctgtatagattttgttcg
gatcgcccatcagaagtacctgagaaatggctgccaataatacttttaacttctgatggc
accatccatcttctcccaggagatgagctgtatgtgaaagactcagacttcttggaaaag
aatatgtctactgacaaaaagactgaagaaatcgtgaaggaaggcaaagtccttaaccga
gttgtgatccacagtccctatgtgtacgaaatctacatgactcttccgtcagagaataag
cacgtgtaccctaggaactacatagtgaataagagatgtactgcccacctgtaa

DBGET integrated database retrieval system