KEGG   Mus musculus (mouse): 111174Help
Entry
111174            CDS       T01002                                 

Gene name
Taar1, Tar1, Trar1, taR-1
Definition
(RefSeq) trace amine-associated receptor 1
  KO
K05051  trace amine associated receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111174 (Taar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    111174 (Taar1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    111174 (Taar1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 111174
NCBI-ProteinID: NP_444435
MGI: 2148258
Ensembl: ENSMUSG00000056379
UniProt: Q923Y8
Position
10; 10 A4
AA seq 332 aa AA seqDB search
MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWL
LHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDR
YCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGG
CSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQ
SKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMV
YAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcatctttgccacgctatcacaaacatttcccacagaaacagcgactggtcaagagaa
gtccaagcttccctgtacagcttaatgtcactcataatcctggccactctggttggcaac
ttaatagtaataatttccatatcccatttcaagcaacttcatacacccaccaactggctc
cttcactccatggccattgtcgactttctgctgggctgtctgataatgccctgcagcatg
gtgagaactgttgagcgctgttggtattttggggaaatcctctgtaaagttcacaccagc
accgatatcatgctgagctccgcctccattttccacttagctttcatttccattgaccgc
tactgtgctgtgtgtgaccctttgagatacaaagccaagatcaatatctccactattctt
gtgatgatcctcgttagttggagccttcctgctgtttatgcatttgggatgatcttcctg
gaactgaacttaaaaggagtggaagagctgtatcgcagtcaggtcagcgacctgggcggc
tgttctcccttctttagtaaagtatctggggtactggcgttcatgacttccttctatata
cctggatctgttatgttatttgtttactataggatatatttcatagctaaaggacaagca
aggtcaatcaatcgtacgaatgttcaagttggattggaagggaaaagccaagcaccacaa
agcaaggaaacaaaagccgcgaagaccttagggatcatggtgggcgttttcctcgtatgc
tggtgcccgttctttctctgcacggtcctggaccctttcctgggctatgttatcccaccc
tctctgaatgacgcactgtattggtttgggtacttgaattctgccctcaatccgatggtt
tatgcctttttctatccctggttcagaagagccttgaagatggttctccttggtaaaatt
ttccaaaaagattcatctaggtctaagctatttttgtaa

DBGET integrated database retrieval system