KEGG   Mus musculus (mouse): 111175
Entry
111175            CDS       T01002                                 

Gene name
Pecr, 2400003B18Rik, TERP
Definition
(RefSeq) peroxisomal trans-2-enoyl-CoA reductase
  KO
K07753  peroxisomal trans-2-enoyl-CoA reductase [EC:1.3.1.38]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111175 (Pecr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    111175 (Pecr)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     111175 (Pecr)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Component type
   111175 (Pecr)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 2-Hacid_dh_C Sacchrp_dh_NADP F420_oxidored Epimerase
Other DBs
NCBI-GeneID: 111175
NCBI-ProteinID: NP_076012
MGI: 2148199
Ensembl: ENSMUSG00000026189
Vega: OTTMUSG00000026657
UniProt: Q99MZ7
Position
1 C3; 1 36.46 cM
AA seq 303 aa
MGSWKTGQSYLAAGLLKNQVAVVTGGGTGIGKAVSRELLHLGCNVVIASRKLDRLTAAVD
ELRASLPPSSSAEVSAIQCNIRKEEEVSNLVKSTLAKYGKINFLVNNGGGQFMAPVEDIT
AKGWHAVIETNLTGTFYMCKEVYNSWMREHGGSIVNIIVLLNNGFPTAAHTGAAREGVYN
LTKSMALAWASSGVRINCVAPGTIYSQTAVDNYGEMGQTLFEMAFDSIPAKRLGVPEEIS
PLVCFLLSPAASYITGQLINVDGGQALYTHAFSIPDHDNWPVGAGDLSIVKRIKESFKKK
AKL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgggctcttggaagactggtcagagctacctagcggccgggttgctgaagaaccaagtg
gccgtggtcaccggcgggggcacaggcattggaaaagccgtctcccgggagctcctgcac
ctggggtgtaacgtggtcattgcttcccggaagctggacagactaactgctgctgtggat
gaactgagagcctctctgcctccctccagctccgctgaagtctccgccatacagtgcaac
atcaggaaagaagaagaggtgagtaatctggtcaaatctaccttagctaagtatggtaag
atcaacttcttggtcaacaatggaggaggccagttcatggctcctgtggaagacatcact
gcgaagggatggcatgctgtgatagaaaccaacctgacaggcaccttctacatgtgcaaa
gaagtttacaattcctggatgagagagcacggagggtcgattgtcaatatcattgtcctt
cttaataatgggtttccaacagccgcgcacactggagcggcaagagaaggtgtttacaac
ctcacaaaatccatggctttggcgtgggccagcagcggagtgaggatcaactgtgtcgct
cctgggaccatttactcccagactgctgttgacaactatggcgaaatgggacaaacctta
tttgagatggcctttgacagtatcccagctaagcgccttggagtccccgaggagatctcc
cctctggtatgtttcctgctgtcccctgcggcttcctatatcactggacagttgatcaat
gtggatggaggccaggctctgtacactcacgccttcagcataccggatcatgacaactgg
cctgtaggagctggggacctttctattgtcaagaggataaaggaatcttttaagaagaaa
gccaagctctaa

DBGET integrated database retrieval system