KEGG   Mus musculus (mouse): 112407
Entry
112407            CDS       T01002                                 

Gene name
Egln3, 2610021G09Rik, AI505553, AI648162, Hif-p4h, Hif-p4h-3, Phd, Phd3, SM-2, SM-20
Definition
(RefSeq) egl-9 family hypoxia-inducible factor 3
  KO
K09592  hypoxia-inducible factor prolyl hydroxylase [EC:1.14.11.29]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04066  HIF-1 signaling pathway
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112407 (Egln3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112407 (Egln3)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    112407 (Egln3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.29  hypoxia-inducible factor-proline dioxygenase
     112407 (Egln3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy_4 ProRS-C_1
Other DBs
NCBI-GeneID: 112407
NCBI-ProteinID: NP_082409
MGI: 1932288
Ensembl: ENSMUSG00000035105
Vega: OTTMUSG00000034921
UniProt: Q91UZ4 A0A0R4J0H9
Position
12; 12 C1
AA seq 239 aa
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQ
LAGPCAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD
NT seq 720 nt   +upstreamnt  +downstreamnt
atgcctctgggacacatcatgaggctggatctggagaagatcgccctggagtacatcgtg
ccctgtctgcacgaggtcggcttctgctacctggacaacttcctaggcgaggtggtgggc
gactgcgtgctggagcgagtcaagcagctgcactacaacggggccctgcgtgacggccag
ctggccgggccgtgcgccggcgtctccaagcggcacctgcgaggcgaccagatcacgtgg
atcgggggcaacgaggagggctgcgaggccatcaacttcctcctgtccctcatcgaccgg
ctggtcctgtactgcgggagccggctgggcaaatactatgtcaaggagcggtccaaggca
atggtggcttgctatccaggaaatgggacaggttatgttcgccatgtggacaaccccaat
ggtgatggccgctgtatcacctgtatctactacctgaataagaattgggacgccaagtta
cacggaggggtcctgcggatatttccggaagggaaatcgtttgtagcagacgtggagccc
atttttgacagacttctgttcttctggtcagaccgcaggaatccacatgaagtccagccc
tcctatgccaccaggtacgctatgactgtctggtacttcgatgctgaagaaagggcagaa
gccaaaaagaaattcaggaatttaactagaaaaactgaatctgctcttgctaaagactga

DBGET integrated database retrieval system