KEGG   Mus musculus (house mouse): 112418
Entry
112418            CDS       T01002                                 
Symbol
1700102P08Rik, AI593206
Name
(RefSeq) RIKEN cDNA 1700102P08 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4712
Other DBs
NCBI-GeneID: 112418
NCBI-ProteinID: NP_444446
MGI: 2148248
Ensembl: ENSMUSG00000032611
UniProt: Q9D9C7
Position
9:108270023..108275416
AA seq 252 aa
MSEKLRRCRKELTAAIDRAFEGVRHSQECTAQQRLDAPSLTSQPVHRLLCRNPLAACPSA
APYSGASCAPESENPAFGTHHIPVNSKLQQPLYPKRKPLTSKENVLMQSSILARDRQFWR
AAGDGEDWRKDSLRKDMERDLKADPNVLLSSSSQEVTKDLLDMIDHTSIRTIEELAGKLE
FENELNRVCGHCQDSPFKEEAWALLVDESPQKALDADPGSLKQALDDQNIVETVLDLEED
YNLMTSFKYQIE
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtctgaaaaactacgaagatgcagaaaggagctgactgctgctatagaccgagccttt
gaaggagtcaggcattctcaggagtgcacagcccagcagaggctggacgccccgtcgctc
acctcccagccggtacacaggctcctctgcagaaacccactggctgcctgcccctctgct
gccccatactctggtgcctcgtgtgctcctgagagtgagaacccggccttcgggacacac
catattccggttaattcaaaacttcagcagcctctataccccaaaaggaaacctctgacc
agcaaggaaaatgtcttgatgcagtcttccattttggcacgtgacagacagttttggaga
gctgcaggtgatggggaagactggagaaaagatagtttaaggaaggatatggagagagat
ttaaaagctgacccaaatgtactgctcagcagttctagccaagaggtcacaaaggatctg
ctagacatgattgaccatacaagtatccgaactattgaagaattggctggaaaactagaa
tttgaaaatgaattgaaccgtgtgtgtggacactgccaagattcacccttcaaggaggaa
gcctgggccctgcttgtggatgagagtcctcagaaggctctggatgctgaccctggtagc
ctcaagcaggctttggatgatcagaatatagttgagactgttctggacttggaagaagac
tacaacttgatgacttcttttaaataccaaatagagtga

DBGET integrated database retrieval system