KEGG   Mus musculus (house mouse): 112422
Entry
112422            CDS       T01002                                 
Symbol
Zfp979, 2610305D13Rik, Ssm1b
Name
(RefSeq) zinc finger protein 979
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-H2C2_2 KRAB zf-C2H2 zf-C2H2_11 zf-C2H2_6
Other DBs
NCBI-GeneID: 112422
NCBI-ProteinID: NP_659544
MGI: 2148252
Ensembl: ENSMUSG00000066000
UniProt: A2A799
Position
4:complement(147696393..147727004)
AA seq 407 aa
MFAPHQESGRRTTKRMSASLENTAQCLLTFKDVFLDFSSEEWECLNFAQRTLYMDVMLEN
YNNLLFVENHCICGNYEKEKVLEQDTQHIFNEHGHIQEKSFKCNESNNIIHESSQSTPHK
TNHRDATLQSSNLKRHKTRTTKEVCTYKDCVNRLKVSSTISLNQGTHIEKKEHNRNKNLD
EVLVSKHKPIVRQNNSEMNTYTCGEFDKCFTQSDNLQSQQRIYPLKKSYKYSESDKCFTQ
KFYLGIHQKIHTGEKFYKCNESDKCFKHKFNLSMHQRIHTGEKTYKCIECNKCFMQQSLL
SNHERIHTGKKPYKCSECDKCFTHQVSLSIHQRIHSEKKPSKYSECEKCFTHKFNLRTHQ
TIHTGEKPYKCSECDKCFTHQVSLRIHQRTHSGEKPYKCTECYKCFA
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtttgctcctcaccaagaatctgggagaagaacaactaaaagaatgagtgcttctctg
gaaaacactgcacagtgtctattaaccttcaaggatgtgtttttggacttctcatcagag
gaatgggaatgtctcaattttgctcagaggacattgtacatggatgtgatgttggagaat
tacaacaatctgttgtttgtggaaaatcactgcatatgtggaaactatgagaaggagaag
gtcttggaacaagacacacagcacattttcaatgagcatgggcatatccaagagaagtct
tttaaatgtaatgagtctaacaatataattcatgaatcctcccaaagtacacctcataaa
actaaccacagagatgccactcttcaatcttcaaacctaaaaagacataaaactcggacc
actaaagaagtttgcacatataaagactgtgtaaaccgtttaaaggtgtcttctaccatt
agtctcaatcaaggaacccacatagagaagaaagaacacaacagaaataaaaatcttgat
gaggttttggtttctaaacataaacccattgtgagacaaaacaatagtgaaatgaacact
tacacttgtggtgaatttgacaaatgctttactcagagtgacaatcttcaaagtcagcag
agaatttatccattaaagaaatcttacaaatatagtgaaagtgacaaatgctttacacaa
aagttctatcttggtatccatcagaaaattcatactggagagaaattttataaatgtaat
gaaagtgacaaatgttttaaacacaaattcaatcttagtatgcatcagagaattcataca
ggagagaaaacttacaaatgcattgaatgtaacaaatgctttatgcaacaatcccttctt
agtaatcatgagagaattcatacaggaaagaagccttacaaatgtagtgaatgtgacaaa
tgctttacccaccaagttagtctgagtattcatcagagaattcattcagaaaagaaacct
tccaaatatagtgagtgtgaaaaatgctttacccacaaatttaatctgagaacacatcag
acaattcatacaggagagaaaccttacaaatgcagtgaatgtgacaaatgctttacccac
caagttagtctgcgtattcatcaaagaactcattcaggagagaaaccttacaaatgtact
gaatgttacaagtgctttgcttaa

DBGET integrated database retrieval system