KEGG   Mus musculus (mouse): 11308Help
Entry
11308             CDS       T01002                                 

Gene name
Abi1, E3B1, NAP1, Ssh3bp1, abi-1
Definition
(RefSeq) abl-interactor 1
  KO
K23649  abl interactor 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Abi_HHR SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 11308
NCBI-ProteinID: NP_001070658
MGI: 104913
Ensembl: ENSMUSG00000058835
Vega: OTTMUSG00000016621
UniProt: Q8CBW3 Q3TPY5
Position
2 A3; 2 15.18 cM
AA seq 481 aa AA seqDB search
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPVSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTAGPAAPGAAPGSQYGTMTRQISRHNSTTSS
TSSGGYRRTPSVAAQFSAQPHVNGGPLYSQNSISVAPPPPPMPQLTPQIPLTGFVARVQE
NIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYSDPYADGDPAWAPKNY
IEKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESIMHYT
D
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcagagctgcagatgttactagaggaggagatcccgtctggcaagagggcgctgata
gagagttaccagaacctgacccgggtggcggactactgtgaaaacaactatatacaggct
acagacaagagaaaagctctagaagagaccaaagcatatacaactcaatctctagctagt
gttgcttatcaaataaatgcattggccaacaatgtgctccagctgctggatatccaagca
tctcagctgcggaggatggagtcatccatcaatcacatctcacagactgtggatattcat
aaagaaaaagtggctcgaagagagattggtattttgacaacaaataagaatacatcaaga
actcacaaaataatcgcacccgcaaatatggagcgtcctgtcaggtatattcggaaacct
atcgactatacagttctggatgatgtgggccatggagttaagtggctaaaagccaagcac
ggaaataaccagcctgcaagaactggcacattgtcgagaacaaaccctcccacgcagaaa
ccaccaagccctcccgtgtcgggccgagggactttgggacggaataccccttacaaaacc
ctagagcctgttaagcctccaacagttcccaatgactacatgactagtcctgcgaggctt
ggaagccagcatagtccaggcaggacagcttctttaaatcagagaccaaggacgcatagt
ggaagtagtggaggaagcggaagccgagagaacagtgggagcagcagcattggcattcct
attgctgtgcctacgccctcaccgcccactgcgggcccagcagcccctggcgcagctcct
ggttcccagtatggcacaatgaccaggcagatttctcgacacaactctaccacttcttcg
acatcttctggtggatatagacgaactccttctgtggccgcccaattctctgctcagcct
catgttaatggaggtccactttattctcaaaattcaatttctgttgcccctcctcctccc
cccatgcctcagttgactccacagatccctctcacaggcttcgtggccagggtgcaggaa
aacattgctgatagcccaactccaccaccaccccctccaccagatgacattcccatgttt
gatgactctccgcctcctccgccacctcctcctgtggactatgaagatgaggaagctgca
gtagttcagtatagtgacccatatgcagatggggaccctgcatgggctcccaagaactat
attgagaaagttgttgcaatatatgattatacaaaagacaaggatgatgagctgtccttt
aaagagggtgcaatcatctatgttataaagaagaatgatgatggctggtttgaaggagtt
tgcaatcgagtgactggactcttccctgggaactatgttgaatcaatcatgcactatact
gattag

DBGET integrated database retrieval system