KEGG   Mus musculus (mouse): 11350
Entry
11350             CDS       T01002                                 

Gene name
Abl1, AI325092, Abl, E430008G22Rik, c-A, c-Abl
Definition
(RefSeq) c-abl oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04110  Cell cycle
mmu04360  Axon guidance
mmu04722  Neurotrophin signaling pathway
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05220  Chronic myeloid leukemia
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    11350 (Abl1)
   04014 Ras signaling pathway
    11350 (Abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    11350 (Abl1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    11350 (Abl1)
  09158 Development and regeneration
   04360 Axon guidance
    11350 (Abl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11350 (Abl1)
   05206 MicroRNAs in cancer
    11350 (Abl1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    11350 (Abl1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    11350 (Abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11350 (Abl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     11350 (Abl1)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  ABL family
   11350 (Abl1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Haspin_kinase Kinase-like SH3_6
Other DBs
NCBI-GeneID: 11350
NCBI-ProteinID: NP_033724
MGI: 87859
Ensembl: ENSMUSG00000026842
Vega: OTTMUSG00000012077
UniProt: P00520
Structure
PDB: 

Position
2 21.86 cM; 2 B
AA seq 1123 aa
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAE
QKDAPDTPELLHTKGLGESDALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLF
SALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPK
ASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSASC
MPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAM
PPPRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKGSAS
GMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACT
GKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQS
TAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTI
TKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAI
NKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgttggagatctgtttgaagttggtgggctgcaaatccaagaaggggctctcttcgtcc
tccagctgctacctggaagaagccctgcagaggccagtggcatctgactttgagccccag
ggtctcagcgaagcagctcgatggaactccaaggaaaaccttcttgctgggcccagtgaa
aatgaccccaacctttttgtggcactctatgattttgtggccagtggagataacactctc
agcatcactaaaggtgaaaagctccgggtcttgggttataatcacaatggggaatggtgt
gaagcccaaacgaaaaatggccaaggatgggtcccaagcaactacatcacccccgtcaac
agcctggagaaacattcctggtatcatggccctgtatctcggaatgctgctgagtatctg
ctgagcagcggaatcaacggcagcttcttagtgcgggagagtgagagtagccctggccag
agatccatctcgctgcggtatgaagggagggtgtaccactacaggatcaacactgcctct
gatggcaagctgtacgtgtcctccgagagccgcttcaacactctggctgagttagttcac
catcactccacggtggctgatggcctcatcaccacactccactacccagctcccaagcgc
aacaagcccactatctacggtgtgtcccccaactacgacaagtgggaaatggagcgcacc
gacatcaccatgaagcacaagttgggtggaggccagtacggggaggtgtacgagggcgtt
tggaagaagtacagcctcactgtggccgtgaagaccttgaaggaggacaccatggaggtg
gaggagttcctgaaggaagcggcggtgatgaaggagatcaaacaccctaacctggtgcag
ctgctaggggtgtgtacccgggaaccaccattctacataatcactgagttcatgacctat
gggaacctgctggactacctgagggagtgtaaccggcaggaggtgagcgccgtggtactg
ctctacatggccacacagatctcatcagccatggagtacttggagaagaagaacttcatc
cacagagaccttgctgcccggaactgcctggtaggggaaaaccacttggtgaaggtggct
gattttggcctgagcaggttgatgacaggggacacctacacggcccatgctggagccaaa
ttccccatcaaatggaccgcacctgagagcctggcctacaacaagttctccatcaagtcg
gacgtgtgggcatttggagtattgctctgggagattgctacctatggcatgtcaccttac
ccgggaattgacctgtctcaggtttatgagctgctggaaaaagactaccgcatggagcgc
cctgaaggctgcccggagaaggtctacgagctcatgcgagcatgttggcagtggaacccc
tctgaccggccctcctttgctgaaatccaccaagcctttgaaaccatgttccaggaatcc
agtatctcagatgaggtggagaaggagctggggaaacgaggcacgagaggaggtgctggg
agtatgctgcaggccccagagctgcccaccaagaccagaacctgcaggagagcagctgag
cagaaagatgcgcctgacacccctgagctgctccacacgaagggcctgggagaaagcgat
gcactggacagtgagcctgctgtatcgccactgcttcctcggaaagagcgcgggccccca
gacggcagcctaaatgaagatgagcgccttctccccagagacagaaagaccaacctgttc
agcgctttgatcaagaagaagaagaaaatggcgccgacgccccctaagcgcagcagttcc
ttccgagagatggatggccagccagaccgcagaggggctagtgaggatgacagcagggaa
ctctgcaatggaccaccagctctcacctcagacgcagcagagcctaccaagtccccaaag
gccagcaatggggctggcgtccctaatggagccttccgggagccgggcaactcaggcttc
cgttctccccacatgtggaaaaagtccagcacactgaccgggagccgcctggctgctgcc
gaagaggagagcggcatgagctccagtaagcgcttcctgcgttcttgttcggcctcctgc
atgccccatggggcaagggacacagagtggcggtcggtcacgctgcctcgagacctgccg
tctgctggcaagcagtttgactcatccacctttggagggcacaaaagcgaaaagccagct
ctgcctcggaaacgcaccagtgagagcaggtctgagcaggtggccaaaagcacggcgatg
ccccctccccggctggtgaagaagaacgaggaggctgctgaagaaggcttcaaagacaca
gaatccagccctggctccagccctcccagcttgactcccaaactcctccgcaggcaggtc
actgcctctccttcctctggcctctctcacaaggaagaggccaccaagggcagtgcctca
ggcatggggactccggccactgcagagccagcaccccccagcaacaaagtgggcctcagc
aaggcctcctctgaggagatgcgcgtaaggaggcacaagcacagctcggagtccccaggg
agagacaaggggcgactggctaagctcaagcctgccccgccgcctcctcctgcctgcaca
ggaaaagcaggcaagcccgcacagagccccagccaagaggccggggaggcaggggggccc
acaaagacaaaatgcacgagtctggctatggatgctgtgaacactgaccccaccaaggcc
ggcccacctggagaaggactgagaaagcctgtgcccccatctgtgccaaagccccagtcg
acggctaagcctccagggactcccaccagcccggtctccaccccctccacagcaccagct
ccttcacccctggctggggaccagcagccatcttctgccgccttcatccccctcatatca
acccgtgtgtctcttaggaagacccgccagccgccagagcgcattgccagtggcaccatc
accaagggtgtggttctggacagtactgaggccctgtgccttgccatctcccggaactca
gagcagatggccagccacagtgctgtactggaggctggcaagaacctgtacactttctgt
gtgagctatgtggactctatccagcagatgaggaacaagtttgccttccgtgaggctatc
aacaagctggagagcaacctccgagagctgcagatctgccctgccacagcctccagtggg
ccagctgccacccaagacttcagcaagctgctcagctctgtgaaggagatcagcgacatt
gtccggaggtag

KEGG   Mus musculus (mouse): 11352
Entry
11352             CDS       T01002                                 

Gene name
Abl2, A, AA536808, Abll, Arg
Definition
(RefSeq) v-abl Abelson murine leukemia viral oncogene 2 (arg, Abelson-related gene)
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    11352 (Abl2)
   04014 Ras signaling pathway
    11352 (Abl2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    11352 (Abl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11352 (Abl2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     11352 (Abl2)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  ABL family
   11352 (Abl2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Haspin_kinase SH3_6 ABC1
Other DBs
NCBI-GeneID: 11352
NCBI-ProteinID: NP_001129576
MGI: 87860
Ensembl: ENSMUSG00000026596
Vega: OTTMUSG00000037114
UniProt: B2RQ57
Structure
PDB: 
4XLI

Position
1 G3; 1 67.71 cM
AA seq 1078 aa
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTADAGFNVFTQHDHFASCVE
DGFEGDKTGGSSPEVLHRPFGCDAESQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDSKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRTASSSSVVPYLPRLPLLPSKTRTLRKQGENKENLDGGLDAAE
SLASSSAPAGFIRSTQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKK
RNAPTPPKRSSSFREMENQPHKKYELTGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQP
EENVDRANDMLPKKSEEGAAPARERPKAKLLPRGATALPLRAPDPAITESDSPGVGVAGV
AAAPKGKERNGGTRLGVAGVPEDGEQLGWSSPAKAVAVLPTTHNHKVPVLISPTLKHTPA
DVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSTCSDPEE
EPTAPPAGQHTPETQEGGKKAAPGPMPSSGKPGRPVMPPPQVPLPTSSISPAKMANGTAG
TKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYV
DSIPQTRNKFAFREAVSKLELSLQELQVSSTAAGVPGTNPVLNNLLSCVQEISDVVQR
NT seq 3237 nt   +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaggctccggggctccagcagccgcagccgcgc
gggatccggggcagcagcgcagccaggccctcgggccgcaggcgggacccggcggggcgt
accgcagacgccggcttcaacgtcttcacccagcacgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagttttgcaccgcccgttt
ggctgtgatgctgaatctcaggcactgaatgaagcgatcaggtggagctccaaggagaac
ttgctgggagccactgagagtgaccctaatctctttgttgcactttatgactttgtggca
agtggtgataacacactcagtatcactaaaggtgaaaagctgcgagtccttggttataac
cagaatggcgagtggagtgaagttcgctccaagaatggacagggttgggtgccaagcaac
tacatcactccagttaatagcctggagaaacattcctggtaccacggacctgtatcccgc
agcgcagcagagtatctcctcagcagcctaatcaatggcagcttcctggttcgagagagt
gagagcagccctgggcagctgtccatctctctcaggtatgagggacgtgtgtatcactac
aggatcaataccaccacagacagcaaggtgtacgtgacagctgagagccgctttagcacc
ttggcagagcttgttcaccaccactccacagttgctgatgggctagtgaccacgctgcac
tacccagcaccgaagtgcaacaagccaaccgtctatggcgtgtctcctatccatgacaag
tgggaaatggaacggacagatatcaccatgaagcacaaacttgggggcggtcagtacgga
gaggtttacgttggcgtctggaagaagtacagccttacagtggctgtgaaaacactgaag
gaagacaccatggaggtggaggagttcctgaaggaagctgcagtgatgaaggagatcaag
catcctaacttagtacaactgctaggtgtgtgtaccctggagccaccgttttacattgtg
actgaatacatgccgtatgggaacctgcttgactatctccgggagtgcagccgagaggag
gtgaccgccgtcgtgttactttacatggccacccagatctcctctgccatggagtacttg
gagaagaagaacttcatccatagagatcttgctgcccggaactgcctagtgggcgagaac
catgtggtgaaagtggccgactttggtttaagtagactgatgactggagatacctacact
gctcatgctggagccaaatttcctattaaatggacagcacccgagagtctggcctacaat
accttttcaattaaatctgacgtttgggcgtttggagtactgttgtgggaaattgctaca
tatggaatgtcaccatatccaggtattgacctatctcaagtctatgacctactggaaaaa
ggatatcgaatggaacagcctgagggatgcccccctaaagtgtatgaacttatgagagca
tgctggaagtggagccctgctgacaggccctcttttgctgaaacccatcaagcttttgaa
acaatgttccatgactccagcatctctgaagaggtagctgaggagcttgggagaacggcc
tcctcctcctctgtggttccatacctgcctcggttaccgctgcttccttccaagacgagg
accctgaggaagcagggggagaacaaagagaacctagatgggggccttgatgccgccgag
agcctggcctccagctcagcaccagcagggttcattagaagcacacaggcctccagtggg
tccccagctctgcctcgaaagcaaagagataagtcgcccagcagcctcttagaagatgcc
aaagagacatgctttaccagggataggaaggggggcttcttcagctccttcatgaaaaag
aggaacgcccccacgcccccgaagcgcagcagctcctttcgagaaatggagaatcagccc
cacaagaaatatgaactcacggggcttccagagcaggataggatggcaatgacccttccc
aggaactgccagaggtccaaactccagctggaaaggacagtgtccacctcttctcaacca
gaagagaatgtggacagggctaatgacatgcttccaaaaaaatctgaggaaggtgctgct
ccagccagggagagaccaaaagccaaactattgcccagaggagccacagctcttcccttg
agagcccctgatccagccatcacagagagtgactctccgggggtaggggtggctggagtg
gcagctgcccccaaaggcaaggaaaggaatggtgggacgcgacttggagtcgctggagtc
cccgaggatggagagcagctaggctggtcttctccagccaaggctgtagctgtcctccca
accactcacaaccacaaagtgccagtccttatctctcccactctgaaacacactccagct
gatgtgcagctcattggcacagactctcaggggaacaaattcaagctcttatctgagcat
caggtcacatcctctggagacaaggaccgaccccgtcgggtaaaaccaaagtgtgcccca
ccccccccaccagtgatgagactactgcagcatccgtccacatgctcagaccccgaggaa
gagccgactgccccacctgcaggacagcacactccagagacccaggagggaggaaaaaag
gcagctccaggcccaatgcccagtagtgggaaacctgggaggccagtcatgcctccacct
caagtgcctttgcccacatcttccatctcaccggccaaaatggccaatggcacagcaggt
actaaggtggccctgaggaaaaccaaacaggcagctgagaaaatctcagctgacaaaatc
agcaaagaggccctgctggagtgtgccgacctactgtccagtgcaatcacggaacctgtg
cccaacagccaactggtggacactgggcaccagctgctcgactactgctcagggtatgtg
gacagcatccctcagactcgcaacaagtttgccttccgagaggctgtgagcaaactggaa
cttagcttacaggagctgcaggtgtcttccacagctgctggtgtgcctgggacaaacccc
gtccttaataacttattgtcgtgtgtacaggaaattagcgatgtggtgcagaggtag

DBGET integrated database retrieval system