KEGG   Mus musculus (mouse): 113851
Entry
113851            CDS       T01002                                 

Gene name
Vmn1r54, V, V1, V1ra9, VN7
Definition
(RefSeq) vomeronasal 1 receptor 54
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    113851 (Vmn1r54)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    113851 (Vmn1r54)
SSDB
Motif
Pfam: V1R TAS2R DUF4079 DUF2593
Other DBs
NCBI-GeneID: 113851
NCBI-ProteinID: NP_444454
MGI: 2148514
Ensembl: ENSMUSG00000047203
Vega: OTTMUSG00000037459
UniProt: Q9EPB8
Position
6; 6 D1
AA seq 315 aa
MNKMNRLSHNTEIRNAIYSGVGIGISGNSFLLLFHIFKYIRGQRSRHIDLPIGLLSLIHL
VMLIAMSLVATDIFMPWGRWGDTTCKCVISLYRFCRSLSLCATSLLSILQAVTLNPRNSC
LEKFKRKSPHYMLGCLLFLSVFYTFISSPLATYITAKSNLTSPSFTYITTSCSLAPMSYS
FHLTVFILLTSRDVIFVGLMLLSSGYMVTFLGRHKKQSQFLHITSFSLKPSAEKRAMRTI
LCLMSFFVLMYTLDSIVSYIRSIDDGQIFYCVHIFTAHGYATVSPFLILSTEKYIINIFR
STFGRMVTIILLRNR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaataaaatgaatagactgtcccataacaccgagataagaaatgctatttattctgga
gttggcattgggatctcaggcaacagcttccttcttctcttccacatcttcaagtacatt
cgtgggcagaggtccagacatattgacctgcccattggtctcttgtccctaatccacctg
gtgatgctgatagccatgagtttagtagctacagacatctttatgccatgggggagatgg
ggtgacaccacatgcaaatgtgttatatccttgtacaggttttgtaggagtctctctctt
tgtgccaccagcctgctcagcatcctccaggctgtcactctcaatcccagaaactcctgc
ttagaaaagttcaagcgtaaatctccacactacatgctaggttgtcttcttttcctgagt
gtcttctatacattcattagcagtccccttgcaacatatataactgcaaagtctaatttg
acctcacctagctttacatatatcactacatcgtgctctctggcacccatgagttactct
ttccatctcacagtttttatactgttgacctccagggatgtcatctttgtaggtctcatg
ctcctctccagtggatacatggtgactttcctaggcagacataaaaagcaatcccaattt
ctccatatcaccagcttttccctcaaaccatctgcagaaaaaagagccatgaggaccatt
ctgtgcctcatgagcttctttgtgctgatgtacaccttggacagcattgtctcctacata
agaagtatcgatgatggtcagattttttattgtgtccacattttcacagcccatggctat
gccacagtcagtccttttttgatcctcagtactgaaaaatatatcatcaacattttcaga
tccacatttggaaggatggtaaccatcatattgctcaggaataggtaa

DBGET integrated database retrieval system