KEGG   Mus musculus (house mouse): 113863
Entry
113863            CDS       T01002                                 
Symbol
Vmn1r15, V1rc6
Name
(RefSeq) vomeronasal 1 receptor 15
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    113863 (Vmn1r15)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    113863 (Vmn1r15)
SSDB
Motif
Pfam: V1R DUF2374
Other DBs
NCBI-GeneID: 113863
NCBI-ProteinID: NP_444466
MGI: 2148527
Ensembl: ENSMUSG00000115199
UniProt: Q14C10
Position
6:57235134..57236033
AA seq 299 aa
MSSVENVLYFQAGFGVLPNVFLLLFYIFIILGHRPKPTDLISCQLTLVHIIMFLTGGNIW
LADIFGFLNIENDIKCKATFYTSRVTRGLSICITCLLSVFQAVTISPSTSMLAKFKQKLK
KYMNNALFYIWFFNLSVCSNMLFFVGGFTNVSETKQVKVTKSCSLFPMNYIIRELIVILS
TSRDVFLVAVMLTTSAYMVNILHRHQRQYKHLHSIKSLRTSPEKKATQTILLLVVFFVVM
YWVDFIISFTSLLLWMYDPVVLTVQKFLIYAYPTITPLVQISSDKRIINVLKNLQSKCH
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtcctcggtagagaatgtcctttatttccaagctgggtttggagtcctacccaatgtg
tttcttcttcttttctatattttcataatcctaggtcacagacctaaacccacagacctg
atctcctgtcaactgactttggttcacataatcatgttcctcactggaggaaatatttgg
ctcgcagacatatttgggtttctaaacattgagaatgacataaaatgtaaagcaactttt
tatacaagtagggtaacgagaggcctctctatctgcattacctgcctcctgagtgttttc
caggctgtcacaatcagtcccagtacctctatgctggcaaaatttaaacagaaacttaaa
aagtacatgaacaatgcattgttctatatttggtttttcaatttgtctgtttgtagtaac
atgcttttctttgttggtggttttaccaatgtcagtgagaccaagcaggtgaaagtcact
aaatcctgctcactcttccccatgaactacatcatcagggaattaattgttattctgtca
acctccagagatgtgtttcttgtagcagtcatgctgaccacaagtgcatatatggtgaat
attttgcacaggcatcagagacaatacaaacatcttcatagcatcaaaagcctgagaaca
tcccctgagaaaaaggccacccagaccatcttgctgctagtagttttctttgtagtcatg
tactgggtggatttcatcatctcattcacctcactcctgttatggatgtatgacccagtc
gtcctgacagttcagaagtttctgatatatgcttatcccacaattactcctttggtacaa
attagttctgataagagaataataaatgtgctgaaaaatttgcagtcaaagtgccactag

DBGET integrated database retrieval system