KEGG   Mus musculus (house mouse): 113864
Entry
113864            CDS       T01002                                 
Symbol
Vmn1r14, V1rc7
Name
(RefSeq) vomeronasal 1 receptor 14
  KO
K04614  vomeronasal 1 receptor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    113864 (Vmn1r14)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    113864 (Vmn1r14)
SSDB
Motif
Pfam: V1R 7tm_1
Other DBs
NCBI-GeneID: 113864
NCBI-ProteinID: NP_444467
MGI: 2148528
Ensembl: ENSMUSG00000114982
UniProt: H3BJ46
Position
6:57203140..57211335
AA seq 303 aa
MSSLSFMSSLLENILYFQAGLGVLANIFLLVFYIFIILGHRPKPMDLISCQLTFVHIMMF
LAGENFWLANIFESLNVENDFKCKATFYTKRVMRGLSICITCLLSVFQAVMISHRNSLLA
KFKHKLKIYMINALFYIWTFNLSLSSNLIFYVGGFTNMSQTKQLKVTKSCSLIPMNYIIR
GLILTVISSRDMFLVGVMLTTSTYMVIILCRHQRQCKHLHSTSHLRASPEKRATQTILLL
VVFFVIMYWVDFIISSTSILLWMYDPVIMIVQKFVVNAYPAITPFVQISSDTRVIRVVKN
WHS
NT seq 912 nt   +upstreamnt  +downstreamnt
atgagttcactttcctttatgtcttcattattagagaatattctttattttcaagctgga
cttggagtcctagccaatatatttcttcttgttttctatatttttataatcctaggccac
agacctaagcccatggacttgatctcctgtcaactgacctttgttcacataatgatgttc
cttgctggagagaatttttggcttgcaaacatatttgagtcactgaatgttgagaatgac
ttcaaatgtaaggcaactttttacacaaagagagtgatgagaggtctctctatctgcatc
acctgcctcctgagtgtgttccaggctgtcatgatcagtcataggaactctttgttggca
aaatttaaacataaactaaaaatatacatgattaatgctttattttatatttggactttc
aatttgtctttaagtagtaacctgatcttctatgttggtggttttaccaacatgagtcag
accaagcagttgaaggtcactaaatcctgctcactcatccccatgaactacattatcagg
ggtttgattttaacagtgataagctccagggatatgtttcttgtaggagtcatgctgact
acaagcacatatatggtgattatcttgtgtagacatcagaggcaatgcaagcatcttcat
agcaccagccacctgagagcatcccccgagaaaagggccactcagaccatcttgctcctg
gtagttttttttgtgattatgtactgggtggactttatcatctcatccacttcaatcctg
ttatggatgtatgacccagtcatcatgattgtccagaagtttgtggtgaatgcttatccc
gcaattactccttttgtacaaatcagttctgatacgagagtaatccgtgtggtaaaaaac
tggcattcttag

DBGET integrated database retrieval system