KEGG   Mus musculus (mouse): 11418Help
Entry
11418             CDS       T01002                                 

Gene name
Asic2, ACIC2, Accn1, BNC1, BNaC1, BNaC1a, Mdeg
Definition
(RefSeq) acid-sensing (proton-gated) ion channel 2
  KO
K04828  acid-sensing ion channel 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04742  Taste transduction
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    11418 (Asic2)
   04750 Inflammatory mediator regulation of TRP channels
    11418 (Asic2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11418 (Asic2)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   11418 (Asic2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 11418
NCBI-ProteinID: NP_001029185
MGI: 1100867
Ensembl: ENSMUSG00000020704
Vega: OTTMUSG00000000859
UniProt: Q925H0 Q3UYD3
Position
11 B5; 11 48.43 cM
AA seq 512 aa AA seqDB search
MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVES
SERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVN
LQIPDPHLADPTVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGH
QDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTF
EAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFP
VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLC
RTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEEEGSHDENMS
TCDTMPNHSETISHTVNVPLQTALGTLEEIAC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaaggagagccccagcgagggcagcctgcaaccttccagcatccagatcttc
gccaacacctctactctccatggcatccgccacatcttcgtgtatgggccgctgaccatc
cggcgtgtgctttgggcagtggccttcgtgggatctctgggcctgctgctggtggagagc
tcggagagagtatcctactatttctcatatcagcatgttaccaaggtggatgaagtggtg
gcccagagcctggtcttcccagctgtgaccctctgcaacctcaatggcttccggttctcc
aggcttaccaccaacgacttgtaccacgctggggagttgctggccctgttggatgtcaac
ttgcagattcctgacccgcatctggcggaccccaccgtgctggaggccctccgacagaag
gccaacttcaaacactacaaaccgaagcagttcagcatgctggagttcctgcaccgggta
ggccatgacctgaaggatatgatgctctactgcaagttcaaggggcaggagtgtgggcat
caagacttcaccacagtgtttacaaaatatgggaagtgttacatgtttaactcaggcgag
gatggcaagcctctgctcaccacggtcaagggggggacgggcaacgggctggagatcatg
ctggacattcagcaagatgagtacctgcccatctggggagagacagaggaaacaacgttt
gaagcaggagtgaaggttcagatccacagccagtctgagccacctttcatccaagagctg
ggctttggggtggctccggggttccagaccttcgtggccacacaagagcagaggctcaca
tatctgcccccgccgtggggggagtgccggtcctcagagatgggactcgacttctttcct
gtttacagcatcacagcctgtcggatcgactgtgagacccgctacatcgtggagaactgt
aactgccgcatggtccacatgccaggggatgcccctttctgcacccctgagcagcacaag
gagtgtgcagagccagccctcggcttactggcagaaaaggacagcaattactgtctctgc
aggacaccctgcaacctgacccgctacaacaaagagctctccatggtaaagatccccagc
aagacgtcagccaagtacctggagaagaaatttaacaaatcggaaaaatatatctccgag
aacattcttgttctggatatattttttgaggcgctcaattacgagacaattgaacagaag
aaggcgtatgaagttgctgccttacttggtgacattggtggtcaaatgggattgttcatt
ggtgctagtatccttacaatactagagctctttgattacatttacgagctgatcaaagag
aagctattagacctgcttggcaaagaagaagaggaagggagccatgatgagaacatgagc
acctgcgacacaatgccaaaccactccgaaaccatcagccacactgtgaacgtgcccctg
cagacagctttgggcaccctggaggagattgcctgctga

DBGET integrated database retrieval system