KEGG   Mus musculus (mouse): 11419
Entry
11419             CDS       T01002                                 

Gene name
Asic1, AI843610, ASIC, ASIC1a, Accn2, B530003N02Rik, BNaC2
Definition
(RefSeq) acid-sensing (proton-gated) ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    11419 (Asic1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11419 (Asic1)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   11419 (Asic1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 11419
NCBI-ProteinID: NP_033727
MGI: 1194915
Ensembl: ENSMUSG00000023017
UniProt: Q6NXK8
Position
15; 15 F1
AA seq 526 aa
MELKTEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFCYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEACS
AEDFKVVFTRYGKCYTFNSGQDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLIYLPSPWGTCNAVTMDSDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCQKEAKRNSADK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggaactgaagaccgaggaggaggaggtgggtggtgtccagccggtgagcatccaggct
tttgccagcagctccacgctgcacggtcttgcccacatcttctcctatgagcggctgtct
ctgaagcgggcactgtgggccctgtgtttcctgggttcgctggccgtcctgctgtgtgtg
tgcactgagcgtgtgcagtactacttctgctaccaccacgtcaccaagctcgacgaggtg
gctgcctcccagctcaccttccctgccgtcactctctgcaacctcaatgagtttcgcttt
agccaagtctccaagaatgacctgtaccatgctggggaactgctggccctgctcaacaac
aggtatgagataccggacacacagatggctgatgaaaagcagctggagatattgcaggac
aaggccaacttccgtagcttcaagcccaagcccttcaacatgcgtgagttctacgacaga
gcagggcatgacattcgagacatgcttctctcgtgccacttccgaggggaggcctgcagc
gctgaagacttcaaagtggtcttcacgcggtatgggaagtgctacacattcaactcgggc
caagatgggcggccacggctgaagaccatgaaaggtgggactggcaacggcctggagatc
atgctggacattcagcaagatgaatacttgcctgtgtggggagagactgatgagacatcg
ttcgaagcaggcatcaaagtgcagatccacagtcaggacgagcctcctttcatcgaccag
ctgggctttggcgtggccccaggcttccagacgtttgtgtcttgccaggagcagaggctc
atctacctgccctccccctggggcacctgcaatgctgttaccatggactcggatttcttc
gactcctacagcatcacggcctgccggattgattgtgaaacccgttacctggtggaaaac
tgcaactgccgtatggtgcacatgccaggggatgccccatactgtactccggagcagtac
aaggagtgtgcagaccctgccctggacttcctagtggagaaagaccaggaatactgtgtg
tgtgagatgccctgcaacctgacccgctacggcaaggagctgtccatggtcaagatcccc
agcaaagcctcagccaagtacctggccaagaagttcaacaaatctgaacagtacataggg
gagaatattctggtgctggacattttctttgaagtcctcaactatgagaccatcgagcag
aagaaggcctatgagatcgcagggcttttgggtgacatcgggggccagatgggattgttc
atcggggccagcatcctcacagtgctggaactctttgactatgcctatgaggtcattaag
caccggctgtgtagacgtgggaagtgccagaaggaggctaagaggaacagcgcagataag
ggcgtggcgctcagcctggatgacgtcaaaagacacaatccctgcgagagcctccgagga
catcctgccgggatgacgtacgctgccaacatcctacctcaccatcccgctcgaggcacg
tttgaggactttacctgctaa

DBGET integrated database retrieval system