KEGG   Mus musculus (mouse): 11421
Entry
11421             CDS       T01002                                 

Gene name
Ace, AW208573, CD143
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu05142  Chagas disease
mmu05171  Coronavirus disease - COVID-19
mmu05410  Hypertrophic cardiomyopathy
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    11421 (Ace)
   04614 Renin-angiotensin system
    11421 (Ace)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    11421 (Ace)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    11421 (Ace)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    11421 (Ace)
   05415 Diabetic cardiomyopathy
    11421 (Ace)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11421 (Ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11421 (Ace)
   04090 CD molecules [BR:mmu04090]
    11421 (Ace)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     11421 (Ace)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M2
   11421 (Ace)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11421 (Ace)
CD molecules [BR:mmu04090]
 Proteins
  11421 (Ace)
SSDB
Motif
Pfam: Peptidase_M2 Peptidase_M32 DUF713 HupF_HypC
Other DBs
NCBI-GeneID: 11421
NCBI-ProteinID: NP_997507
MGI: 87874
Ensembl: ENSMUSG00000020681
Vega: OTTMUSG00000003113
UniProt: P09470 Q3TU20
Position
11 E1; 11 68.84 cM
AA seq 1312 aa
MGAASGQRGRWPLSPPLLMLSLLVLLLQPSPAPALDPGLQPGNFSPDEAGAQLFAESYNS
SAEVVMFQSTVASWAHDTNITEENARRQEEAALVSQEFAEVWGKKAKELYESIWQNFTDS
KLRRIIGSIRTLGPANLPLAQRQQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTNI
LASSRSYAKLLFAWEGWHDAVGIPLKPLYQDFTAISNEAYRQDDFSDTGAFWRSWYESPS
FEESLEHIYHQLEPLYLNLHAYVRRALHRRYGDKYVNLRGPIPAHLLGDMWAQSWENIYD
MVVPFPDKPNLDVTSTMVQKGWNATHMFRVSEEFFTSLGLSPMPPEFWAESMLEKPTDGR
EVVCHASAWDFYNRKDFRIKQCTRVTMEQLATVHHEMGHVQYYLQYKDLHVSLRRGANPG
FHEAIGDVLALSVSTPAHLHKIGLLDHVTNDIESDINYLLKMALEKIAFLPFGYLVDQWR
WGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHIPNVTPYIRYFVSFV
LQFQFHQALCKEAGHQGPLHQCDIYQSAQAGAKLKQVLQAGCSRPWQEVLKDLVGSDALD
AKALLEYFQPVSQWLEEQNQRNGEVLGWPENQWRPPLPDNYPEGIDLETDEAKADRFVEE
YDRTAQVLLNEYAEANWQYNTNITIEGSKILLEKSTEVSNHTLKYGTRAKTFDVSNFQNS
SIKRIIKKLQNLDRAVLPPKELEEYNQILLDMETTYSLSNICYTNGTCMPLEPDLTNMMA
TSRKYEELLWAWKSWRDKVGRAILPFFPKYVEFSNKIAKLNGYTDAGDSWRSLYESDNLE
QDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDLV
APFPSAPNIDATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREV
VCHPSAWDFYNGKDFRIKQCTSVNMEDLVIAHHEMGHIQYFMQYKDLPVTFREGANPGFH
EAIGDIMALSVSTPKHLYSLNLLSTEGSGYEYDINFLMKMALDKIAFIPFSYLIDQWRWR
VFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYVRYFVSFIIQ
FQFHEALCRAAGHTGPLHKCDIYQSKEAGKLLADAMKLGYSKPWPEAMKLITGQPNMSAS
AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTARAEGSTAESNRVNFLGLYLEPQQA
RVGQWVLLFLGVALLVATVGLAHRLYNIRNHHSLRRPHRGPQFGSEVELRHS
NT seq 3939 nt   +upstreamnt  +downstreamnt
atgggggccgcgtccggccagcgggggcggtggccgttgtcgcctccgctcttgatgctg
tcgctgctggtgctgttgctgcagccgtcgcccgccccggcactcgaccctggattgcag
ccgggcaacttttccccggacgaggcaggggcgcagcttttcgctgaaagctataactcg
agtgccgaggtggtgatgttccagagcaccgtggccagttgggcgcacgacaccaacatc
acggaggagaacgcgcgacgccaggaggaagcggccctggtcagccaggagtttgcagag
gtctggggcaagaaggccaaggagttgtatgagtccatttggcagaactttactgactca
aagctgcgaaggatcatcggatctattcggaccctaggacctgccaatctgcccctggcc
cagcggcagcagtacaactctctgctaagcaacatgagcagaatctactccactggcaag
gtctgcttccccaacaagactgccacctgctggtccctggacccagagctcaccaacatc
ctggcttcctcacgaagctatgccaagttgttgtttgcctgggagggctggcatgatgct
gtgggtatcccactgaaacccctctatcaagactttactgccatcagtaacgaagcctac
agacaagacgacttctcagacacaggagccttctggcgctcctggtatgagtccccctcc
tttgaggagagtctggaacatatctaccaccaactagagcccctctacctgaacctccat
gcctacgtccgccgcgcactgcaccgccgctatggggacaaatacgtcaatctcaggggg
cctattcctgcccatttgctgggagacatgtgggcccagagctgggagaacatctacgac
atggtagtgcctttcccagacaaacccaacctcgatgtcaccagtacaatggtacagaag
ggctggaacgccacacacatgttccgggtatcagaggaattcttcacctcgctggggctc
tcacccatgcctcctgagttctgggcggagtcaatgctggagaaaccaacggatggacgg
gaggtggtgtgccacgcctctgcctgggacttctacaaccggaaggacttccggattaag
caatgcacacgggtcacgatggaacagctggccacagtacaccacgagatgggccacgtg
cagtactacctccagtacaaggacctgcacgtctctctgcgtagaggtgccaaccctggc
ttccatgaggccattggggatgtgcttgcactctccgtctctacccctgcacatctgcac
aaaatcggcctactggaccatgttaccaatgacatagagagtgacatcaattacctgcta
aagatggccctagagaaaatcgccttcttgccctttggctacctggtggaccagtggcgt
tggggggtcttcagtggacggaccccaccctctcgctacaacttcgactggtggtatctt
cgaaccaagtatcaggggatctgcccaccagttgcccggaatgaaacccattttgatgct
ggagccaagtttcacatcccaaacgtgacaccgtacatcaggtacttcgtgagctttgtg
ctgcagttccagttccatcaagcactgtgcaaggaggcaggccaccagggcccactacac
cagtgtgacatctaccagtccgcccaggcgggggccaagctcaagcaggtgttgcaggct
ggctgctccaggccctggcaggaggtactgaaggacctggtaggctcagatgccctggat
gccaaggcactgctggagtacttccaaccggtcagccagtggctggaagagcagaatcag
cggaatggcgaagtcctaggctggccagagaatcagtggcgtccaccgttacccgacaac
tatccagagggcattgacctagagactgatgaagccaaggctgacaggttcgtggaagag
tatgaccggacagcccaagtgttgttgaacgagtacgcagaggccaactggcaatataac
accaacattaccatagagggcagcaagatcctgcttgagaaaagcacggaggtatccaat
cacaccctgaaatatggcacccgggccaagacatttgatgtgagcaactttcaaaactct
tccatcaagcggatcataaagaagcttcagaacctggaccgggcagtgctgcctcccaag
gaattagaagagtacaaccagatcctgctagacatggagacaacttacagcttatccaac
atttgctacacaaatggcacttgtatgcccctggaacctgatctaacaaacatgatggcc
acatcccggaaatatgaagaattgctatgggcatggaagagctggagagacaaggtgggg
agagccatccttccttttttcccaaagtatgtggagttctccaacaagattgccaagctc
aatggctacacggatgcaggggattcatggagatccttatacgagtctgacaacctggag
caagacctggaaaaactgtaccaggagctgcagccactctacctgaacctgcatgcctat
gtgcgtcgttccctgcaccgccactatgggtccgagtacatcaacctggatggccccatt
cctgcccatctgctagggaacatgtgggcgcagacctggtccaacatctatgatttggtg
gcgcccttcccttccgcccccaatatagatgccacggaagccatgataaagcagggatgg
acacccagaaggatatttaaggaagctgacaatttctttacctccctggggctgttacct
gtgccccctgagttctggaacaagtcgatgttagagaagcccaccgatggaagggaggtg
gtgtgccatccctcagcctgggacttctacaacggcaaggacttcaggatcaagcagtgt
acctctgtgaacatggaggacttggtgatagcgcaccacgaaatgggccacatccagtat
ttcatgcagtacaaagacttacccgtgactttccgggagggtgccaaccctggttttcat
gaagctattggagatataatggctctctcagtgtctacccccaagcatctatacagtctc
aacctgcttagcactgagggcagtggctacgagtatgacatcaactttctaatgaagatg
gccctcgacaagatcgcctttatccccttcagctacctcatcgaccagtggcgctggagg
gtctttgatggaagcatcaccaaggagaactataaccaggagtggtggagcctcaggctg
aagtatcagggtctgtgccccccagtgccaagatcccaaggtgactttgacccagggtcc
aagttccacgttcctgcgaacgtgccatacgtcaggtactttgtcagcttcatcatccag
ttccagttccacgaggcgctgtgtcgcgcagccgggcacacgggtcccctgcacaagtgt
gacatctaccaatccaaggaagcagggaagctcctggcggatgccatgaagctgggctac
agtaagccgtggccagaggccatgaagctgatcacaggccagcctaacatgtcagcctcc
gccatgatgaattacttcaagccactgacagaatggctcgtcaccgagaacaggagacat
ggagagacactgggctggccggagtacaactgggcgccaaacaccgctcgcgcagaaggc
tccaccgcagagtccaaccgcgtcaatttcctgggcctgtacctggagccacagcaggcc
cgcgtgggccagtgggtgctgctcttcctgggcgtcgccctgctcgtggccaccgtgggt
ctcgcccatcggctctacaacatccgtaaccatcacagcctccgccggccccaccgtggg
ccccagtttgggtctgaggtggagctcagacactcctga

KEGG   Mus musculus (mouse): 217246
Entry
217246            CDS       T01002                                 

Gene name
Ace3, EG217246
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu05142  Chagas disease
mmu05171  Coronavirus disease - COVID-19
mmu05410  Hypertrophic cardiomyopathy
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    217246 (Ace3)
   04614 Renin-angiotensin system
    217246 (Ace3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    217246 (Ace3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    217246 (Ace3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    217246 (Ace3)
   05415 Diabetic cardiomyopathy
    217246 (Ace3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    217246 (Ace3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    217246 (Ace3)
   04090 CD molecules [BR:mmu04090]
    217246 (Ace3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     217246 (Ace3)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M2
   217246 (Ace3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   217246 (Ace3)
CD molecules [BR:mmu04090]
 Proteins
  217246 (Ace3)
SSDB
Motif
Pfam: Peptidase_M2 Cse1 DUF4131 RGS_DHEX
Other DBs
NCBI-GeneID: 217246
NCBI-ProteinID: NP_001094923
MGI: 3644400
Ensembl: ENSMUSG00000101605
Vega: OTTMUSG00000033693
UniProt: D0G895
Position
11; 11 E1
AA seq 737 aa
MNLPWALLLVLLSHRQLLPWLRTVGETSLNDFYSEAQAKLFLQFYEQTAQVVLNEFMEAT
WNYVTNITKQNQKNMLQKEADRSQFMLYFSTRARMFRTDHFLNQDVKRMLRKLQNIDKSA
LPTEDLLEYNRLLTYMETAYNRAEVCLDEGPCLTLEPDLQEIMATSRDQKELLWAWQGWR
DAVGRQLRPVFEDYVRLSNKAAQYNGYKDMGALWRSKYESDTLEEDLEQLYKELQPLYLN
LHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLPYPTKAPEDITAIMK
IQHWRPEKMFEEANLFFTSMGMLPAPPAFWIKSMMEKPADGREVECHTSSWNFYKFNDFR
VKKCTEVTLEDLLSVFHQMGHIQYFLQYQNLSVIYQEGASPAFEEAVGSVIALSVSSHKY
LLARGLLSQPHQDSEEEVNFLLGIALEKIAFIPFSYLVDKFRWKIFDGTISKITYNQEWW
NFRLKYQGLCPPVPRSDDDFDPGAKFHIPANVPYIRYFLGLILQFQLHEALCEASGHVGP
LHQCDNYNSKVAGKILGDLLKLGSSRPWREVLQEVTGESNISTKAFLTYFKPLMDWLVTE
NVKQGDTLGWPDFSCSFEEKITSKVSFLGTDTEPEQAYLGQWVLLSMSFFMLVLILALGF
RLHYLEKQLLDEDTMILKTLPYSYFLGIAMEPHQAARKQWLLLGLCCILMLCCIGLLIRI
VTQNTENTPWMKNEGQS
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgaacttgccctgggccttgctacttgtgctcctctctcaccggcaactcttgccatgg
ctcaggactgtgggagagacaagcttaaatgatttctacagcgaggctcaggctaagttg
ttcctgcagttttatgagcaaacagcccaggtcgtgttgaatgagtttatggaagccact
tggaactacgtcaccaacatcaccaagcagaatcaaaagaacatgctgcagaaggaggcg
gacaggtctcagtttatgttatacttcagcacccgggcccgcatgtttaggacagaccat
ttcctgaaccaggacgtgaagcgcatgctgaggaagctgcagaacatagacaagtcggcc
ttgcccacggaggatctcctagagtacaacagacttctgacctacatggagacagcatat
aaccgagctgaggtgtgcctggatgagggtccctgcttgaccctagagcctgacctccaa
gaaatcatggccacctccagggaccagaaggagctgctgtgggcctggcagggctggcgg
gatgctgttggccgacaactccgccctgtctttgaggactacgtacgtctcagcaacaag
gctgcccaatataatggatacaaagacatgggggctttatggcgatccaagtatgaatct
gacacgctggaggaagacctagagcagctctataaggagctgcagcctctctacctgaac
ctccatgcctatgtgcgccgctcactgtaccgctactacgggcctgagctcattgacctg
agggggcccatccctgcccacctcctggggaacatgtgggctcagtcctggaataatatc
ctagatctggtcctgccctatccgactaaagccccagaggacatcacagcgatcatgaag
atccagcactggaggcctgagaaaatgtttgaagaggctaacttattctttacctcaatg
ggcatgctacccgccccgcctgctttctggataaagtctatgatggagaagccagctgac
gggcgggaagtggagtgccacacctcatcctggaacttctacaagttcaatgacttcagg
gtaaagaagtgcacggaagtgaccttagaagacctgctctccgtcttccaccagatgggc
catatccagtacttcttgcagtatcagaatctctctgtcatctaccaggaaggtgccagc
ccagcctttgaagaggctgtggggtcggtgatcgccctctcagtctcttcccacaagtac
ctgctcgccagaggtctgctcagccaacctcaccaggattcagaggaggaggtcaacttc
ctgttaggcattgccctggagaagattgccttcatccccttcagctacctggtagacaag
tttcgttggaagatctttgatggcactatttcgaagattacatacaaccaggagtggtgg
aacttcaggttgaagtaccaaggcctgtgcccacctgtccctcgatcagacgatgatttt
gacccaggtgccaagtttcacatccctgccaatgtgccctatatccgatactttcttggt
ctgatactgcagtttcaacttcatgaagcactatgcgaagcctccggccacgtgggccct
ctgcaccagtgcgataactacaactccaaggttgcagggaagatcttgggggatctcctg
aagttgggctccagccggccctggcgggaggtcctccaggaggtgactggagagtccaat
atatccaccaaggcctttttgacctacttcaagccactgatggactggctggtgactgaa
aacgtgaagcaaggggacacccttggctggccagacttcagctgttcttttgaagaaaaa
atcacaagcaaagtatcgtttctgggcacagacacagagcctgagcaggcgtacctgggg
cagtgggtgttgctgagcatgagttttttcatgttggtcctcatcctggcactgggcttc
aggctgcactacttggaaaaacagttactggacgaagacacaatgattcttaagaccctg
ccctactcctacttcctgggcatagccatggaaccccatcaggcagcccggaaacagtgg
cttctgctgggcctctgctgcatccttatgctgtgctgtattggcctgctcattcggata
gtcacgcagaacaccgagaacactccatggatgaaaaatgaagggcagagctga

DBGET integrated database retrieval system