KEGG   Mus musculus (mouse): 114228
Entry
114228            CDS       T01002                                 

Gene name
Prss1, Try-1, Try1, Trygn16
Definition
(RefSeq) protease, serine 1 (trypsin 1)
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 114228
NCBI-ProteinID: NP_444473
MGI: 98839
Ensembl: ENSMUSG00000062751
Vega: OTTMUSG00000026897
UniProt: Q9Z1R9
Position
6 B1; 6 19.6 cM
AA seq 246 aa
MSALLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKTRIQVRLGEHNINVLEGNEQFIDAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLN
ARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYPGKIT
GNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQ
DTIAAN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgagtgcactcctgttcctggcccttgtgggagctgctgttgctttccctgtggatgat
gatgacaagatcgttggaggatacacctgccgagagaattctgttccctaccaggtgtcc
ctgaactctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtct
gcagctcattgctacaagacccgcatccaagtgagattgggggagcacaatatcaatgtc
ctggagggcaatgagcagtttatcgatgctgccaagatcatcaagcaccccaacttcaat
aggaagaccctgaacaatgacatcatgttgatcaagctctcatcccctgtgaccctcaat
gccagagtggccactgtggctctgcccagctcctgtgcacctgctggcactcagtgtctc
atctctggctggggcaacactcttagctttggtgtcagtgaaccagacctgctccagtgc
ctggatgccccactgctgcctcaggctgactgtgaggcttcctatcctgggaagatcact
ggtaacatggtctgtgctggcttcctagagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgcaatggagagctccagggcattgtctcttggggctatggctgt
gccctgccagacaatcctggtgtgtacaccaaggtctgcaactatgtggattggattcag
gacacaattgctgccaactag

DBGET integrated database retrieval system