KEGG   Mus musculus (house mouse): 114230
Entry
114230            CDS       T01002                                 
Symbol
Aipl1, A930007I01Rik
Name
(RefSeq) aryl hydrocarbon receptor-interacting protein-like 1
  KO
K17767  AH receptor-interacting protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04934  Cushing syndrome
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    114230 (Aipl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114230 (Aipl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    114230 (Aipl1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114230 (Aipl1)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_8 FKBP_C TPR_11 TPR_16 TPR_9 ANAPC3
Other DBs
NCBI-GeneID: 114230
NCBI-ProteinID: NP_444475
MGI: 2148800
Ensembl: ENSMUSG00000040554
UniProt: Q924K1 Q9CTQ3
Structure
Position
11:complement(71919527..71933184)
AA seq 328 aa
MDVSLLLNVEGVKKTILHGGTGELPSFITGSRVTFHFRTMKCDDERTVIDDSKQVGQPMS
IIIGNMFKLEVWETLLTSMRLGEVAEFWCDTIHTGVYPMLSRSLRQVAEGKDPTSWHVHT
CGLANMFAYHTLGYEDLDELQKEPQPLVFLIELLQVEAPNEYQRETWNLNNEERMQAVPL
LHGEGNRLYKLGRYDQAATKYQEAIVCLRNLQTKEKPWEVEWLKLEKMINTLILNYCQCL
LKKEEYYEVLEHTSDILRHHPGIVKAYYMRARAHAEVWNAEEAKADLEKVLELEPSMRKA
VLRELRLLESRLADKQEEERQRCRSMLG
NT seq 987 nt   +upstreamnt  +downstreamnt
atggacgtctctctactcctcaatgtggagggtgtcaagaagaccattctgcatgggggg
acgggagagctccccagcttcatcactggctctcgagtgacctttcatttccgcacaatg
aagtgtgatgacgagcgcacggtgatcgatgacagcaagcaggtgggccagcccatgagc
atcatcatcggcaacatgttcaagctggaggtgtgggagacgctgctgacctccatgcgg
ctgggcgaggtggctgagttctggtgcgacaccattcacacaggggtctaccctatgttg
tcccgcagtctgcggcaggtggctgagggcaaggaccccacaagctggcatgtgcacacg
tgcgggttggccaacatgtttgcataccacacgctgggctacgaggacctggatgagctg
cagaaagagccacagcctcttgtcttcctgattgaactgttgcaggtggaggccccaaat
gagtaccagagggagacgtggaacctgaataatgaagagaggatgcaggcggtacctctt
cttcatggagaaggcaacaggctctacaagctgggacgctatgatcaggccgccaccaag
taccaggaggccattgtgtgcctgaggaaccttcagaccaaggagaagccctgggaggtt
gagtggctgaagctggagaagatgatcaacaccctgatcctcaactactgccagtgcctg
ctgaagaaggaggagtactacgaggtgttggagcacaccagcgacattctacgacaccac
ccagggatcgtgaaggcctactatatgcgcgcacgtgctcacgcagaggtgtggaacgct
gaggaggccaaggcggacctggagaaagtgctggagttggagccatccatgcgcaaggcg
gtgctcagggaactgcggctgctggagagccgcctggcggacaaacaggaggaggagcgg
cagcgctgccggagcatgctgggctag

DBGET integrated database retrieval system