KEGG   Mus musculus (mouse): 114249
Entry
114249            CDS       T01002                                 

Gene name
Npnt, 1110009H02Rik, AA682063, AI314031, Nctn, PO, POEM
Definition
(RefSeq) nephronectin
  KO
K06824  nephronectin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    114249 (Npnt)
SSDB
Motif
Pfam: cEGF EGF_CA MAM EGF_3 FXa_inhibition EGF EGF_MSP1_1 EGF_2 C_tripleX
Other DBs
NCBI-GeneID: 114249
NCBI-ProteinID: NP_001025007
MGI: 2148811
Ensembl: ENSMUSG00000040998
Vega: OTTMUSG00000026534
UniProt: Q91V88
Position
3; 3 G3
AA seq 561 aa
MAVLLAAVLASSLYLQVAADFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPQCKHGECVGPNKCKCHPGFAGKTCNQDLNECGLKPRPCKHRCMNTFGSYKCYCLNGYM
LLPDGSCSSALSCSMANCQYGCDVVKGQVRCQCPSPGLQLAPDGRTCVDIDECATGRVSC
PRFRQCVNTFGSYICKCHTGFDLMYIGGKYQCHDIDECSLGQHQCSSYARCYNIHGSYKC
QCRDGYEGDGLNCVYIPKVMIEPSGPIHMPERNGTISKGDGGHANRIPDAGSTRWPLKTP
YIPPVITNRPTSKPTTRPTPNPTPQPTPPPPPPLPTEPRTTPLPPTPERPSTRPTTIAPA
TSTTTRVITVDNRIQTDPQKPRGDVFIPRQPTNDLFEIFEIERGVSADEEVKDDPGILIH
SCNFDHGLCGWIREKDSDLHWETARDPAGGQYLTVSAAKAPGGKAARLVLRLGHLMHSGD
LCLSFRHKVTGLHSGTLQVFVRKHGTHGAALWGRNGGHGWRQTQITLRGADVKSVIFKGE
KRRGHTGEIGLDDVSLKRGRC
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggctgtgctcctagcggcggtgctcgcgtcctcgctctacctgcaggtggctgccgac
ttcgacgggaggtggcccaggcaaatagtttcttcaatcggcctatgtcgctatggaggc
aggattgactgctgctggggctgggcccgccagtcctggggacagtgccaacctgtgtgt
caaccacagtgcaaacacggagagtgcgtcgggccaaacaagtgcaaatgtcaccctgga
tttgctgggaaaacctgcaaccaagatttaaacgagtgtggcctgaagcctcggccctgt
aagcacaggtgcatgaacactttcggcagctacaagtgctactgtctcaacggatacatg
ctgctgccagacgggtcctgctcaagtgccctatcgtgttccatggcaaactgtcagtat
ggctgtgacgtggtcaaaggacaggtccgatgtcagtgtccatcccctggcctgcagcta
gctcccgatgggaggacctgtgtggatattgatgaatgtgcgactggaagagtctcctgc
cctcgatttaggcagtgtgtcaacacgtttgggagctacatctgcaagtgtcacactggt
ttcgacctcatgtacattggaggcaaatatcagtgccatgacatcgacgagtgctctctt
ggacagcaccagtgtagcagctatgcccggtgttacaacatacatgggtcctacaagtgc
caatgtagagatggatacgagggggatggactgaactgtgtgtatatccccaaagtcatg
attgaaccttcaggtccaatccatatgccagaaagaaatggtacaatctcaaagggtgat
ggaggacatgcgaataggattcctgatgctggaagtacaaggtggcccctgaagacacca
tatattcctcctgtcattaccaacaggcctacttccaagccaacaacaagacctacacca
aacccaacaccacagcctactccaccacctccaccacccctcccgacagagcccagaaca
actccactaccaccaaccccagaaaggccatctaccagacccaccactatagcacctgct
accagtaccactacacgagtaattacggttgacaacaggatacagacggatcctcagaaa
cccagaggagatgtgttcattccacggcagccgacaaatgacctgtttgagatatttgaa
atcgaaagaggggtcagcgcggatgaggaagtaaaggacgacccaggtattctcatacac
agctgcaattttgaccatggactctgtggatggatcagagaaaaagatagtgacttgcac
tgggagacagccagggacccagcaggtggacagtatctcacagtgtctgcagccaaagcc
ccggggggaaaagccgctcgcttggtgttacgtctcggccacctcatgcattcaggggac
ctgtgcctgtcctttaggcacaaggtgactgggctgcactcgggcacactgcaggtgttt
gtgaggaaacacggtacccacggagcagccctgtggggaagaaatggtggccatggctgg
aggcaaacccagatcaccttgcgaggggctgacgtcaaaagcgtcatcttcaaaggtgaa
aaaaggcgtggtcacacgggggagattggattggatgatgtgagcttgaaaagaggtcgc
tgctga

DBGET integrated database retrieval system