KEGG   Mus musculus (mouse): 114255
Entry
114255            CDS       T01002                                 

Gene name
Dok4
Definition
(RefSeq) docking protein 4
  KO
K24037  docking protein 4/5/6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    114255 (Dok4)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   114255 (Dok4)
SSDB
Motif
Pfam: IRS PH PH_11 RGM_C
Other DBs
NCBI-GeneID: 114255
NCBI-ProteinID: NP_444476
MGI: 2148865
Ensembl: ENSMUSG00000040631
Vega: OTTMUSG00000061707
UniProt: Q99KE3
Position
8; 8 C5
AA seq 325 aa
MATNFNDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDIS
LGEPDLLAPGVQCEQTDRFNVFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWP
LCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLE
MEKNVRLLNKGTEHYSYPCTPTAMLPRSAYWHHITGSQNIAEASSYGESYGAAQASSETD
LLNRFILLKPKPSQEDSSEAKTPAQ
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgaccaatttcaacgacatcgtcaagcaaggctatgtgaagatgaagagcaggaag
ctcgggatttaccggaggtgctggctggtgttccggaaatcttccagcaaggggccccag
cggctggagaagtatcctgatgagaagtccgtgtgcctccgaggctgccccaaggtgact
gagattagcaacgtcaagtgtgtcacacggctccccaaggagaccaagaggcaggcggtg
gccatcatattcacagacgactccgctcgcaccttcacttgtgactcagagctggaggca
gaagagtggtacaagacactgtccgtggaatgtctgggatcacggctcaatgacatcagc
ctgggagagcctgacctcctggctccaggagtacagtgtgagcagacagatcgcttcaac
gtcttcctgttaccctgccccaacctggacgtgtatggggagtgcaagctgcagatcact
cacgagaacatctacctctgggacatacacaacccccgcgtgaagctcgtctcgtggccc
ctctgctctttgcgccgttatggccgagatgctacgcgctttacctttgaggcgggcagg
atgtgtgacgctggggaagggctctatacctttcagacacaggagggggagcagatttac
cagcgggttcacagtgccaccctggccatcgccgagcagcacaagcgggtcctgctggag
atggagaagaatgtgaggctgctgaacaagggcaccgagcactactcctatccctgcaca
cccacggccatgctgccccgcagcgcgtactggcaccatatcacaggttctcagaacatt
gctgaagcctccagctatggggaaagttatggggcagcccaggccagctcggaaacagac
ctcctgaacaggttcatcttgcttaagccaaagcccagtcaggaggatagcagtgaggcc
aagacccctgcccagtga

DBGET integrated database retrieval system