KEGG   Mus musculus (mouse): 11430
Entry
11430             CDS       T01002                                 

Gene name
Acox1, A, AOX, Acox, D130055E20Rik, Paox
Definition
(RefSeq) acyl-Coenzyme A oxidase 1, palmitoyl
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00410  beta-Alanine metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu00640  Propanoate metabolism
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04024  cAMP signaling pathway
mmu04146  Peroxisome
Module
mmu_M00087  beta-Oxidation
mmu_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    11430 (Acox1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11430 (Acox1)
   00592 alpha-Linolenic acid metabolism
    11430 (Acox1)
   01040 Biosynthesis of unsaturated fatty acids
    11430 (Acox1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    11430 (Acox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    11430 (Acox1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    11430 (Acox1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    11430 (Acox1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     11430 (Acox1)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 11430
NCBI-ProteinID: NP_001258827
MGI: 1330812
Ensembl: ENSMUSG00000020777
Vega: OTTMUSG00000003754
UniProt: Q9R0H0
Position
11; 11 E2
AA seq 661 aa
MNPDLRKERAAATFNPELITHILDGSPENTRRRREIENLILNDPDFQHEDYNFLTRSQRY
EVAVKKSATMVKKMREFGIADPEEIMWFKKLHMVNFVEPVGLNYSMFIPTLLNQGTTAQQ
EKWMHPSQELQIIGTYAQTEMGHGTHLRGLETTATYDPKTQEFILNSPTVTSIKWWPGGL
GKTSNHAIVLAQLITRGECYGLHAFVVPIREIGTHKPLPGITVGDIGPKFGYEEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVFVRSFLVGSAAQSLSKACTIA
IRYSAVRRQSEIKRSEPEPQILDFQTQQYKLFPLLATAYAFHFLGRYIKETYMRINESIG
QGDLSELPELHALTAGLKAFTTWTANAGIEECRMACGGHGYSHSSGIPNIYVTFTPACTF
EGENTVMMLQTARFLMKIYDQVQSGKLVGGMVSYLNDLPSQRIQPQQVAVWPTLVDINSL
DSLTEAYKLRAARLVEIAAKNLQAQVSHRKSKEVAWNLTSVDLVRASEAHCHYVTVKVFA
DKLPKIQDRAVQAVLRNLCLLYSLYGISQKGGDFLEGNIITGAQMSQVNSRILELLTVTR
PNAVALVDAFDFKDVTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYYKHLKPLQSK
L
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaatcccgatctgcgcaaggagcgggccgccgccaccttcaatccagagttaatcacg
cacatcttggatggtagtccggagaacacccggcgccgtcgagaaatcgagaacttgatt
ctgaacgatccagacttccaacatgaggactataacttcctcactcgaagccagcgttac
gaggtggctgttaagaagagtgccaccatggtgaagaagatgagggaatttggcatcgca
gaccctgaagaaatcatgtggtttaaaaaactacatatggtcaattttgtggaacctgtt
ggcctcaattactccatgtttatccctaccttgctgaatcagggcaccactgctcagcag
gagaaatggatgcacccgtcccaagaactccagataattggcacctacgcccagacggag
atgggccacggaactcatcttcgaggcttggaaaccactgccacatatgaccccaagacc
caagagttcattctcaacagcccaactgtgacttccatcaagtggtggcctggggggctt
gggaagacttccaatcatgcgatagtcctggctcagctcatcactcgaggggagtgctac
gggttacatgcctttgttgtccctatccgtgagattgggacccacaagcctctgccaggc
atcactgttggggatatcggccccaagtttggttatgaagagatggataatggctacctg
aagatggacaattaccgtattcctagagagaacatgttgatgaaatatgcccaggtgaag
cctgacggcacgtatgtaaaacctctgagtaacaagctgacatatgggaccatggttttc
gtaaggtccttcctcgtgggaagtgcagctcagagtctgtccaaggcatgcaccattgcc
attcgatacagtgctgtgaggcgccagtctgaaatcaagagaagcgagccagagccccag
attttggattttcagacgcagcagtataaactcttcccgctcctggccaccgcctatgcc
ttccactttctcggaagatacataaaggagacctacatgcggattaatgagagcattggc
caaggcgacctgagtgagctgcctgagcttcatgccctcacagctgggctgaaggctttt
actacctggacagccaatgctggtatcgaagaatgtcggatggcttgcggtgggcacggc
tattctcacagcagtgggattccaaatatttacgtcacgtttaccccggcctgcaccttc
gagggggagaacactgttatgatgctgcagacggccaggttcttgatgaaaatctatgac
caggttcagtcggggaagctggtgggtggtatggtgtcgtacttgaatgacctgccgagc
cagcgtatccagccgcagcaggtggcagtctggccaactctggtggacattaacagcctg
gacagcctgacagaagcctacaagctacgtgcagccagattggtagaaattgctgcaaaa
aaccttcaggcccaagtgagtcacaggaagagcaaggaagtggcgtggaacttgacttct
gtcgaccttgttcgcgcaagtgaggcgcactgccactacgtgaccgttaaggtctttgca
gataaactccccaagattcaagacagagccgtgcaagccgtgctgaggaacctgtgtctc
ttatattctctctatgggatcagccagaaaggaggggattttcttgaggggaacatcatc
acaggggctcagatgtcacaggtaaacagtcggatcctggagctgctcacagtgactcgc
cccaacgctgtggctttggtggatgcctttgactttaaggatgtgacccttggctctgtt
ctcggccgctatgatggcaatgtgtatgaaaacttgtttgagtgggccaagaagtcccca
ctgaacaagacagaggtccacgaatcttactacaagcacttgaagcccctgcagtcgaag
ctttga

KEGG   Mus musculus (mouse): 80911
Entry
80911             CDS       T01002                                 

Gene name
Acox3, BI685180, EST-s, EST-s59, PC, PCOX
Definition
(RefSeq) acyl-Coenzyme A oxidase 3, pristanoyl
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00410  beta-Alanine metabolism
mmu00592  alpha-Linolenic acid metabolism
mmu00640  Propanoate metabolism
mmu01040  Biosynthesis of unsaturated fatty acids
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04024  cAMP signaling pathway
mmu04146  Peroxisome
Module
mmu_M00087  beta-Oxidation
mmu_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    80911 (Acox3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    80911 (Acox3)
   00592 alpha-Linolenic acid metabolism
    80911 (Acox3)
   01040 Biosynthesis of unsaturated fatty acids
    80911 (Acox3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    80911 (Acox3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    80911 (Acox3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    80911 (Acox3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    80911 (Acox3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     80911 (Acox3)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 80911
NCBI-ProteinID: NP_109646
MGI: 1933156
Ensembl: ENSMUSG00000029098
Vega: OTTMUSG00000023571
UniProt: Q9EPL9
Position
5; 5 B3
AA seq 700 aa
MGSLPEEKDSALWSDTPKGPLSAYRARASFNSGELLLFWDGQDVIHFKKTIFSTLENDPL
FARSYGADLPLEKLRELNFLRCKRVFEYGFFKVEELLKNPLKILVLINCLGMYDWSLANK
CVLHMLVFGTTVFVSGSEKHFKYLEKIYSLEIFGCFALTELSHGSNTKAMRTTAHYDPDT
QEFILHSPDFEAAKFWVGNLGKTATHAVVFAQLYMPDGQCHGLHSFLVQIRDTKTLLPMT
GVMVGDIGKKLGQNGLDNGFAMFNKVRIPRQNLLDRTGNITSEGTYNSPFKDVRQRLGAS
LGSLSSGRISIISMSVVNLKLAVSIAIRFSATRCQFGPTDKEEIPVLEYPLQQWRILPYL
AAAYALDHFSKTIFMDLIEVQSARLRGDHSDQQAELGREIHALASAGKPLASWTAQRGIQ
ECREACGGHGYLAMNRFGDLRNDNDPNCTYEGDNNVLLQQTSNYLLSLLEPPLQDGAHFT
SPLKTVDFLEAYPGILGQKFLGSSKADWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSR
GSDFEARNNSQVYGCRPLALAFMELTVMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCL
SQHMALLYRGGYISGEQTGRAMEDAILTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADG
ELYKNLWAAVLQQNGVLERAAWWPEFSANKSVADRLKSQL
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgggatccctaccggaagaaaaagacagtgctttgtggtcagacacccccaagggccct
cttagtgcctaccgagcaagagcctccttcaactctggggagctgctgctcttttgggac
ggccaggatgtaatccacttcaagaaaaccatcttctcaactttggagaatgaccctctc
tttgcccgctcgtacggggccgacctgcccctagagaagctacgagaactgaacttcctt
cgctgcaagagggtctttgagtatggcttcttcaaagtagaggaactgctaaagaacccc
ctgaagattctagtgctgattaactgcctgggcatgtacgactggtccctggccaacaaa
tgcgtcctccacatgttggtttttggaaccacagttttcgtttctggttctgagaagcat
ttcaagtaccttgagaagatctatagcctggagatttttggctgttttgctctcaccgaa
ctgagtcatgggagtaataccaaggccatgcgaacgacagctcactatgatcctgatact
caggaattcatcttacattccccggatttcgaggctgccaaattttgggtgggcaacctg
ggcaagacggcaactcatgcggtggtgtttgcccaactgtacatgccagacggccagtgc
cacgggctgcattccttcctggtgcagatccgtgacacgaagaccctgcttcccatgacg
ggggtgatggtcggtgacattgggaagaagctggggcagaatggcctggataatggattc
gccatgttcaacaaagttcgaattcctcgccagaacctgctggacaggactgggaatatc
acctctgagggcacttacaacagcccctttaaggatgtccggcagcgtttgggcgcatca
ttgggcagcctgtcctcaggacgcatctccatcatcagcatgtctgtggtcaacctgaag
ctggccgtgtccatagccatccggttctcggccacacggtgtcagtttggacccacggat
aaggaagagattcctgtccttgaatatccactgcagcaatggcgcatacttccgtacctg
gcggctgcctatgccttggaccacttctctaagacaatcttcatggacttgatagaggtg
cagagtgcccggctcaggggagaccacagcgaccagcaggcagaactcggacgtgagatc
catgctctggcatcggctggcaagcctctagcctcatggacagcccagcggggtatccag
gagtgccgtgaggcgtgtgggggacatggctacctggccatgaaccggtttggtgacctc
agaaacgacaacgacccaaactgtacctatgaaggtgacaacaatgtcctgctgcagcag
accagcaactacctgctcagcctcctggagcctcctctccaagacggagctcacttcaca
agccctctcaagaccgtggactttctggaagcctatcctggaatcttgggccagaagttc
ctgggctccagcaaggctgactggatggactcagcagcccccctggcagcctaccgctgg
cttgtttgctacttgctccaagagagccatcggagatactgccaagagaaaaagtccaga
ggcagtgactttgaagcaagaaacaacagccaggtgtacggctgccggcccctggccctg
gccttcatggaactcaccgtgatgcagcgattccacgaacatatacacagctccggtctg
tctccatctctgcggactgtgctcgggcggctcagcacgctctacggcctgtggtgcctg
agccagcacatggccctgctctaccgaggtggctacatttctggggaacaaacaggaaga
gcgatggaggacgccatcctgaccctgtgtgagcagctgaaagacgatgcggtggccttg
gtagatgtcatcgccccctccgactttgttctgaactccccaattgccaaagctgatggt
gagctctataaaaacctgtgggcagctgtcctgcagcagaatggtgtgctagagcgtgcc
gcctggtggcccgagttctctgccaacaaatctgtagccgacaggctaaagtcccagctg
tag

DBGET integrated database retrieval system