KEGG   Mus musculus (mouse): 11431
Entry
11431             CDS       T01002                                 

Gene name
Acp1, 4632432E04Rik, AI427468, Acp, Acp-1, LMW-, LMW-PTP, Lm, Lmptp
Definition
(RefSeq) acid phosphatase 1, soluble
  KO
K14394  low molecular weight phosphotyrosine protein phosphatase [EC:3.1.3.2 3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00730  Thiamine metabolism
mmu00740  Riboflavin metabolism
mmu01100  Metabolic pathways
mmu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    11431 (Acp1)
   00740 Riboflavin metabolism
    11431 (Acp1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    11431 (Acp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    11431 (Acp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     11431 (Acp1)
    3.1.3.48  protein-tyrosine-phosphatase
     11431 (Acp1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class II PTPs
   Low molecular weight PTPs (LMWPTPs)
    11431 (Acp1)
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-GeneID: 11431
NCBI-ProteinID: NP_001103709
MGI: 87881
Ensembl: ENSMUSG00000044573
UniProt: Q9D358 Q561M1
Structure
PDB: 
2P4U

Position
12; 12 A2
AA seq 158 aa
MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRA
VSCLRNHGISTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTY
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcagaggttgggtccaagtcagtgctgttcgtgtgtctcggtaacatttgccggtca
cccattgcagaagcagtattcaggaaactggtaactgatgaaaaggtttcagataattgg
gccattgacagcagcgccgtttccgactggaacgtgggccggcccccagacccaagagct
gtcagctgcctaagaaatcatggcattagcacagcccataaggcaagacagattacaaaa
gaagactttgccacattcgattatatactatgtatggatgaaagcaatctgagagatctc
aatagaaaaagtaatcaagttaaaaactgcaaagctaaaattgagctacttgggagctat
gatccacagaaacagctcatcattgaagatccctattatggcaatgactctgacttcgag
gtggtgtaccagcaatgccttaggtgctgcaaggccttcctggagaagacttactag

DBGET integrated database retrieval system