KEGG   Mus musculus (mouse): 11433
Entry
11433             CDS       T01002                                 

Gene name
Acp5, T, TR, TRACP, TRAP
Definition
(RefSeq) acid phosphatase 5, tartrate resistant
  KO
K14379  tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00740  Riboflavin metabolism
mmu01100  Metabolic pathways
mmu04142  Lysosome
mmu04380  Osteoclast differentiation
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    11433 (Acp5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11433 (Acp5)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    11433 (Acp5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    11433 (Acp5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     11433 (Acp5)
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-GeneID: 11433
NCBI-ProteinID: NP_001095874
MGI: 87883
Ensembl: ENSMUSG00000001348
Vega: OTTMUSG00000062335
UniProt: Q05117
Position
9 A3; 9 8.38 cM
AA seq 327 aa
MDSWVVLLGLQIIWLPLLTHGTAPTPTLRFVAVGDWGGVPNAPFHTAREMANAKEIARTV
QTMGADFIMSLGDNFYFTGVHDASDKRFQETFEDVFSDRALRNIPWYVLAGNHDHLGNVS
AQIAYSKISKRWNFPSPYYRLRFKIPRTNITVAIFMLDTVMLCGNSDDFASQQPKMPRDL
GVARTQLSWLKKQLAAAKEDYVLVAGHYPIWSIAEHGPTRCLVKNLRPLLATYGVTAYLC
GHDHNLQYLQDENGVGYVLSGAGNFMDPSVRHQRKVPNGYLRFHYGSEDSLGGFTHVEIS
PKEMTIIYVEASGKSLFKTSLPRRPRP
NT seq 984 nt   +upstreamnt  +downstreamnt
atggattcatgggtggtgctgctgggcctacaaatcatatggctcccactcctgacccac
ggtacagcccccactcccaccctgagatttgtggctgtgggcgactggggaggggtcccc
aatgccccattccacacagcccgggaaatggccaatgccaaagagatcgccagaaccgtg
cagacgatgggcgctgacttcatcatgtctctgggggacaatttctacttcactggagtg
cacgatgccagcgacaagaggttccaggagacctttgaggacgtgttctctgaccgtgcc
cttcgcaacatcccctggtatgtgctggctggaaaccatgatcaccttggcaacgtctct
gcacagattgcatactctaagatctccaagcgctggaacttccccagcccttactaccgt
ttgcgcttcaaaattccacgtacaaacataactgtggccatctttatgctggacacagtg
atgctgtgtggcaactcagatgactttgccagtcagcagcccaaaatgcctcgagacctg
ggagtggcccgcactcagctgtcctggctcaaaaagcagttggcagcagccaaggaggac
tacgttttggtggccggccactaccccatctggtccatcgccgagcacggacccacgcgc
tgccttgtcaagaacttgcgaccattgttagccacatacggggtcactgcctacctgtgt
ggacatgaccacaacctgcagtatcttcaggacgagaacggtgtgggctatgtgctgagt
ggggccggcaacttcatggatccctctgtgcgacatcaacgaaaggtccccaacggctac
ttgcggtttcactatggatctgaggactccctgggcggcttcacacatgtggagataagc
cccaaagaaatgaccatcatatatgtggaagcctctggaaaatcactctttaagaccagc
ctcccaaggagacccagaccctga

DBGET integrated database retrieval system