KEGG   Mus musculus (house mouse): 11434
Entry
11434             CDS       T01002                                 
Symbol
Acr
Name
(RefSeq) acrosin prepropeptide
  KO
K01317  acrosin [EC:3.4.21.10]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11434 (Acr)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11434 (Acr)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     11434 (Acr)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   11434 (Acr)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    11434 (Acr)
SSDB
Motif
Pfam: Trypsin Trypsin_2
Other DBs
NCBI-GeneID: 11434
NCBI-ProteinID: NP_038483
MGI: 87884
Ensembl: ENSMUSG00000022622
UniProt: P23578
Position
15:89452529..89463056
AA seq 436 aa
MVEMLPTVAVLVLAVSVVAKDNTTCDGPCGLRFRQNSQAGTRIVSGQSAQLGAWPWMVSL
QIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNKKKVYDWRLVFGAQEIEYGRNKPVKEP
QQERYVQKIVIHEKYNVVTEGNDIALLKITPPVTCGNFIGPCCLPHFKAGPPQIPHTCYV
TGWGYIKEKAPRPSPVLMEARVDLIDLDLCNSTQWYNGRVTSTNVCAGYPEGKIDTCQGD
SGGPLMCRDNVDSPFVVVGITSWGVGCARAKRPGVYTATWDYLDWIASKIGPNALHLIQP
ATPHPPTTRHPMVSFHPPSLRPPWYFQHLPSRPLYLRPLRPLLHRPSSTQTSSSLMPLLS
PPTPAQPASFTIATQHMRHRTTLSFARRLQRLIEALKMRTYPMKHPSQYSGPRNYHYRFS
TFEPLSNKPSEPFLHS
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggtagagatgctgccaactgtcgctgtgctggtcttggcagtgtccgtggttgccaag
gataacaccacgtgtgatggtccctgtgggttacgattcaggcagaactcacaagcaggt
acccggattgtcagtgggcagagtgcgcagcttggggcctggccctggatggtcagctta
cagatcttcacgtcccataacagccgcaggtaccacgcctgtggaggcagcctcctgaac
tcccactgggtgctcacagctgcccactgcttcgataacaaaaaaaaagtctatgactgg
agactggttttcggagcacaagaaatcgaatatggaagaaacaagccagtgaaagagccc
cagcaggagagatatgtgcagaagattgtcatccatgagaaatacaacgtagtgacggag
ggaaatgacattgcgctcttgaagatcactcctcctgttacatgtgggaacttcattgga
ccctgctgtctacctcattttaaggcgggtcctccccaaataccccacacctgctacgtg
actgggtggggatacataaaagagaaggcccccaggccatcacctgtcctgatggaagca
cgtgtggacctcattgacctcgacctgtgtaactcaacccagtggtacaatgggcgtgtc
acatcgactaatgtgtgtgcagggtatcctgaaggcaagattgacacctgccagggggac
agtggtgggcctctcatgtgcagagacaacgtcgacagcccctttgtggtcgtggggatc
acgagctggggggtaggctgtgcccgtgctaagcgtcccggagtctacacagccacctgg
gactacctggactggattgcttccaagatcggccctaacgccttgcacttgattcagcca
gccacccctcatccgccgactacccgccatccgatggtctcttttcaccctccttctctt
cgccctccttggtatttccaacacctgccttctcgaccgctttacctgcgaccactacgg
cctctgctccatcggccgtcttcgacccaaacctcctcatcactcatgcccctcctctcg
cccccaaccccagcccagcctgcatcctttaccattgctacacaacacatgaggcaccgc
acaacgctgtcttttgctcggcgtctccagcgcctcatagaggccctgaagatgagaact
taccctatgaaacatccctcccagtacagtggaccaaggaactaccactaccgcttctcc
acgtttgagcccctttccaacaaacccagcgagcccttcctccattcctga

DBGET integrated database retrieval system