KEGG   Mus musculus (mouse): 11435
Entry
11435             CDS       T01002                                 

Gene name
Chrna1, AI385656, AI608266, Achr-1, Acra
Definition
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle)
  KO
K04803  nicotinic acetylcholine receptor alpha-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11435 (Chrna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    11435 (Chrna1)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   11435 (Chrna1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4980 Claudin_2
Other DBs
NCBI-GeneID: 11435
NCBI-ProteinID: NP_031415
MGI: 87885
Ensembl: ENSMUSG00000027107
Vega: OTTMUSG00000013434
UniProt: P04756 Q05A24
Structure
PDB: 
2QC1 5HBV

Position
2 C3; 2 43.76 cM
AA seq 457 aa
MELSTVLLLLGLCSAGLVLGSEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQL
INVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDF
AIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINP
ESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRLPLYFIVNVII
PCLLFSFLTSLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLF
TMVFVIASIIITVIVINTHHRSPSTHIMPEWVRKVFIDTIPNIMFFSTMKRPSRDKQEKR
IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGVKYIAETMKSDQESNNAAEEWK
YVAMVMDHILLGVFMLVCLIGTLAVFAGRLIELHQQG
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagctctcgactgttctcctgctgctaggcctctgctccgctggccttgttctgggc
tccgaacatgagacgcgtctggtggcaaagctctttgaagactacagcagtgtagtccgg
ccagtggaggaccaccgtgagattgtacaagtcaccgtgggtctacagctgatccagctt
atcaatgtggatgaagtaaatcagattgtgacaaccaatgtacgtctgaaacagcaatgg
gtcgattacaacttgaaatggaatccagatgactatggaggagtgaaaaaaattcacatc
ccctcggaaaagatctggcggccggacgtcgttctctataacaacgcagacggcgacttt
gccattgtcaaattcaccaaggtgctcctggactacaccggccacatcacctggacaccg
ccagccatctttaaaagctactgtgagatcattgtcactcactttcccttcgatgagcag
aactgcagcatgaagctgggcacctggacctatgacggctctgtggtggccattaacccg
gaaagtgaccagcccgacctgagtaacttcatggagagcggggagtgggtgatcaaggaa
gctcggggctggaagcactgggtgttctactcctgctgccccaccactccctacctggac
atcacctaccacttcgtcatgcagcgcctgcccctctacttcattgtcaacgtcatcatt
ccctgcctgctcttctccttcttaaccagcctggtgttctacctgcccacagactcaggg
gagaagatgacgctgagcatctctgtcttactgtccctgaccgtgttccttctggtcatt
gtggagctaatcccttccacctccagcgctgtgcccctgatcgggaagtatatgttgttc
accatggtctttgtcattgcgtccatcatcatcaccgtcatcgtcatcaacacacaccac
cgttcgcccagcacccacatcatgcccgagtgggtgcggaaggtttttatcgacactatc
ccaaacatcatgtttttctccacaatgaaaagaccatccagagataaacaagagaaaagg
atttttacagaagacatagatatatctgacatctctgggaagccgggtcctccacctatg
ggctttcactctccgctgatcaagcaccctgaggtgaaaagcgccatcgagggcgtgaag
tacattgcagagaccatgaagtcagaccaggagtccaataacgccgctgaggaatggaag
tatgttgccatggtgatggatcacatcctcctcggagtctttatgctggtgtgtctcatc
gggacgctggctgtgtttgcaggtcggctcattgagttacatcaacaaggatga

DBGET integrated database retrieval system